Similar sites like currylawgroup.com

Brandon Attorneys | Curry Law Group, P.A.

Facing legal issues in Brandon, FL? Let Curry Law Group, P.A. help. Schedule an initial consultation to get started today.

Categories: Business, Government and Legal Organizations
Topics: brandon attorneys, curry law group

currylawgroup.com Reviews

Sites similar to currylawgroup.com - Top 55 currylawgroup.com alternatives

egriffinlaw.com
Griffin & Associates, P.A., Attorneys in Brandon FL - Hillsborough County, Florida
Griffin & Associates, P.A. is a small, well established and highly regarded law firm in the Tampa Bay community.

Categories: Business, Political Organizations

Similar?
Yes 0 No 0

belainejoneslaw.com
Law Office Brandon, FL | The Law Office of B. Elaine Jones
Florida Family Law, DUI, Criminal Law Attorney serving Brandon, FL and surrounding areas. Trust a lawyer who cares about your justice, call us at 813-681-8383

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

mensdivorcetampa.com
Men's Divorce Attorney Tampa | Law Office of Thor Hartwig
Divorce attorney in Tampa, Florida that focuses exclusively on men's
divorce and family law. Including: Divorce, child support, child custody
and alimony.

Categories: Business, Business

Similar?
Yes 0 No 0

klmlawoffice.com
The Law Office of Kari L. MacDonald, P.A. | Brandon FL Family Attorney - Providing peace of mind, when it matters most.
The Law Office of Kari L. MacDonald
Providing peace of mind, when it matters most.
A legal team with an eye on justice.
We are committed to getting you the settlement you deserve.

If you have been charged with a crime, are going through a divorce

Semrush Rank: 8,925,792
Categories: Business, Business

Similar?
Yes 0 No 0

marashaughnessy.com
Brandon Family Law Attorney | Mara Shaughnessy
Brandon Family Law Attorney | Mara Shaughnessy

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

marybethcorn.com
Attorney | Brandon, FL | The Law Offic of Mary Beth Corn
In search of a family attorney? Call us today in Brandon, FL!

Categories: Business, Business

Similar?
Yes 0 No 0

thecurrylawfirm.com
The Curry Law Firm
The Law Firm was started with one thing in mind: helping people. The legal
system can be a confusing and scary process for people. The Firm's goal is
to help guide and assist you through the process. We are here to listen and
help. We work for you.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

brandonpersonalinjurylawfirm.com
Boohoff Law, P.A.
Looking for an attorney for personal injury in Brandon? Boohoff Law, P.A. has a track record of success and is the recipient of the Clients' Choice Award. Call today and schedule a free consultation! Available to clients 24/7.

Categories: Business, Political Organizations

Similar?
Yes 0 No 0

gilllawoffice.com
Brandon Divorce Attorney | The Law Office of Thomas P. Gill, Jr.
Attorney Gill is a divorce & family law attorney in Brandon FL who has given compassionate, experienced support to families since 1988. Call for a free consultation.

Semrush Rank: 4,229,752
Categories: Business, Advertising

Similar?
Yes 0 No 0

faulknerlawgroup.com
Tampa Criminal Lawyer
Tampa criminal lawyer David Faulkner handles drug crimes, DUI, s*x crimes, traffic offenses, as well as family law, contested divorce & child custody disputes.

Semrush Rank: 3,606,824
Categories: Business, Business

Similar?
Yes 0 No 0

scrivenlawfirm.com
Tampa Criminal Lawyer
Tampa criminal lawyer Bryant Scriven helps with DUI, drug charges, traffic offenses, s*x crimes, theft, white-collar, federal criminal law & more.

Semrush Rank: 13,739,517
Categories: Business, Business

Similar?
Yes 0 No 0

inlawwetrust.com
Divorce Lawyers For Men Tampa - Divorce For Men Tampa FL | In Law We Trust, P.A.
Experienced divorce lawyers for men in Tampa FL offering a variety of legal services. Call (813) 415-3510 today for a free consultation with a divorce for men specialist.

Semrush Rank: 4,275,941
Categories: Business, Business

Similar?
Yes 0 No 0

thecurrylawfirmllc.com
Attorney at Law in North Charleston, SC | The Curry Law Firm
Attorney at law Eduardo K. Curry represents clients in family law, criminal defense, probate, & personal injury cases. North Charleston & Walterboro, SC.

Semrush Rank: 2,067,138
Categories: Business, Business

Similar?
Yes 0 No 0

tblcpa.com
Family Law Attorney | Divorce Lawyer | Brandon FL | 813-341-3333
Attorney Carl Ohall is Brandon, FL's most trusted Family Law & Divorce Attorney. Contact us today at 813-341-3333 for a Free Consulation with compassionate service.

Semrush Rank: 2,918,736
Categories: Business, Business

Similar?
Yes 0 No 0

suarezlawfirm.com
Ed Suarez : Tampa's Top White Collar Criminal Defense Attorney
In a world full of lawyers, you will rarely find trial attorneys as capable, approachable, and committed to their clients as Ed Suarez and Rachel May Zysk. Our attorneys have successfully represented clients in state and federal courts throughout Florida and elsewhere.

Semrush Rank: 3,709,864
Categories: Business, Business

Similar?
Yes 0 No 0

divorceformen.us
Clearwater Divorce & Separation Attorney | Divorce for Men
Divorce For Men, in Clearwater, Florida, represents men and fathers in family law matters. Call 727-416-7145.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

davidchicolaw.com
davidchicolaw.com
Sucuri WebSite Firewall - Access Denied

Categories: Business, Business

Similar?
Yes 0 No 0

porchlight.law
Porchlight | Family Law for the Modern Family ®
Porchlight | Family Law for the Modern Family®

Semrush Rank: 1,674,883
Categories: Business, Business

Similar?
Yes 0 No 0

hersemlaw.com
Hersem Law | Tampa Criminal Defense Lawyer
Picking the right criminal defense attorney in Tampa will impact the severity of your sentence! Don't let a mistake ruin your life. Call 813-544-4162!

Moz DA: 24 Moz Rank: 3.3 Semrush Rank: 877,358
Categories: Business, Business

Similar?
Yes 0 No 0

brandondivorcelawyer.com
Brandon Divorce Lawyer | Divorce Lawyers In Brandon Fl - 813-291-2540
If You Are Seeking a Divorce Lawyers In Brandon, Fl, This Brandon Divorce Lawyer Is Here For You! Call Our Brandon Divorce Attorney For Legal Consultation.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

brandonlegalgroup.com
Brandon Legal Group, Family Law and General Attorneys
Experienced legal counsel, with a focus on Families, and their legal needs, from divorce to wills and trusts. Child Custody to major purchase transactions.

Semrush Rank: 2,679,465 Facebook ♡: 1,058
Categories: Business, Business

Similar?
Yes 0 No 0

valerieglong.com
Valerie Long, Attorney at Law in Columbus, GA
Getting free from burdensome debt can alter the course of your life. Our Georgia legal team can smoothly guide you through your bankruptcy options.

Semrush Rank: 488,959
Categories: Blogs/Wiki, Web Hosting

Similar?
Yes 0 No 0

brandonlawoffices.com
Brandon Family Attorney | Family Law | Divorce | BRANDON LAW
Brandon family attorney, experienced & compassionate; specializing in friendly family law, divorce, estate planning & probate, personal injury

Semrush Rank: 8,433,705
Categories: Business, ???

Similar?
Yes 0 No 0

shraderlawfirm.com
Top Tampa Criminal Defense Attorney - Shrader Mendez & O'Connell in Tampa, Florida
Hillsborough County criminal defense lawwyers in Tampa, Florida, providing top representation for those wrongly accused of crimes in Florida.

Semrush Rank: 3,320,465
Categories: Business, Business

Similar?
Yes 0 No 0

criminaldefenselawyertampa.com
Criminal Defense Lawyers of Tampa
Daniel J. Fernandez and Martin J. Hernandez

Semrush Rank: 2,951,296
Categories: Business, Domain Parking

Similar?
Yes 0 No 0

brartamber.com
Criminal Lawyer Brampton | Litigation Lawyers Toronto | Brar Tamber
Brar Tamber - Top litigation Lawyers in Brampton. We have highly experienced personal injury lawyers, criminal lawyer. Contact us!

Semrush Rank: 12,021,555
Categories: Business, Business

Similar?
Yes 0 No 0

bairdlawgroup.com
Home - Baird Law Group
Personal Injury Attorneys Who Care Get the settlement you deserve Tampa's Injury Lawyer What's my case worth? Featured in $10+ Million to Injured Clients Peer Rated and Awarded Baird Law Group has been awarded the highest level of ratings in the legal field. 18 Years Experience Cory Baird gradated from Stetson in 2001 and has been serving Florida since. $ZERO Fee Unless We Win “If you don’t get paid, we don’t get paid” Personal touch Cory Baird will be your ...

Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

rombrolaw.com
Family Lawyer - Manhattan Beach, CA | Rombro & Manley LLP
Rombro & Manley LLP helps California families through divorce and other family law matters. We are strong, compassionate allies for our clients. 310-545-1900.

Semrush Rank: 1,230,780
Categories: Business, Business

Similar?
Yes 0 No 0

floridawomenslawgroup.com
Divorce Attorney for Women, Jacksonville Divorce Lawyers, Family Law Firm Description
Florida Women's Law Group is the only divorce and family law firm for breadwinner women and their families in Florida to fight for you. Call (904) 241-0012 NOW!

Semrush Rank: 1,684,647
Categories: Business, Business

Similar?
Yes 0 No 0

terryandrobertslaw.com
terryandrobertslaw.com
Sucuri WebSite Firewall - Access Denied

Semrush Rank: 392,287
Categories: Business, Business

Similar?
Yes 0 No 0

genuslawgrp.com
Our Albuquerque Divorce, Custody, and Guardianship Lawyers Will Take on the Work and Worry to Successfully Resolve Your Family Law Case
Our ABQ Divorce attorneys will help you in your Divorce, Custody, and Guardianship case in New Mexico. Protect yourself, your assets, and your family by contacting Albuquerque's best divorce lawyers.

Semrush Rank: 306,124 Facebook ♡: 2,167
Categories: Business, Business

Similar?
Yes 0 No 0

thehardylawfirm.com
thehardylawfirm.com
Sucuri WebSite Firewall - Access Denied

Semrush Rank: 599,241
Categories: Marketing/Merchandising, Political Organizations

Similar?
Yes 0 No 0

dennislopezlaw.com
DUI & Traffic Ticket Attorneys in Tampa | Florida Criminal Defense Law Firm | Dennis A. Lopez, Attorney at Law
If you've received a DUI charge or traffic ticket in Tampa, contact Dennis A. Lopez, Attorney at Law for skilled representation.

Semrush Rank: 1,949,572
Categories: Business, Business

Similar?
Yes 0 No 0

thefernandezlawgroup.com
Fernandez Law Group: Tampa Lawyers & Attorneys at Law
Fernandez Law Group Tampa Lawyers & Attorneys at Law: Personal Injury, Criminal Defense, DUI & Traffic Violations. FREE Consultations. 813-489-3222

Semrush Rank: 1,455,969
Categories: Business, Political Organizations

Similar?
Yes 0 No 0

learydefense.com
Law Office of Tim Leary - Criminal Defense Attorney
TIMOTHY LEARY | SEATTLE CRIMINAL DEFENSE ATTORNEY If you or someone you know is accused of any criminal offense, you will need an experienced and knowledgeable lawyer who will protect your legal rights. Call Tim Leary today at 206-382-2401.

Categories: Business, Business

Similar?
Yes 0 No 0

jerkinsfamilylaw.com
Family Law Attorney | Raleigh, NC | Jerkins Family Law
If you are looking for a family law attorney in Raleigh, NC, then contact Jerkins Family Law. Whether it's Divorce or Child Custody we have you covered!

Semrush Rank: 761,007
Categories: Business, Information Technology

Similar?
Yes 0 No 0

harrlawfirm.com
Daytona Beach Divorce Attorney - Family Law Firm | The Harr Law Firm
Entrust your legal needs with the premier, respected law firm in Daytona Beach. Call 386-226-4886 for a consultation with The Harr Law Firm. Injured? Call The Harr Law Firm, your Daytona Beach divorce attorney and personal injury attorney.

Semrush Rank: 317,423
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

betzlawfirm.com
St. Louis Divorce & Family Law Attorney - The Betz Law Firm
Free Consultation call (314) 801-8488 :: A family law attorney should be someone you can trust to help you through some of the most difficult times in your life

Semrush Rank: 1,126,301
Categories: Business, Business

Similar?
Yes 0 No 0

shapirofamilylaw.com
Best Denver Family Law Attorneys | Shapiro Family Law
Our experienced Denver Family Law lawyers are here to help you get the best possible outcome. Call Shapiro Family Law at 303-695-0200.

Semrush Rank: 283,463
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

familymaritallaw.com
Tampa Divorce Attorneys-Free Consult-Top Tampa Family Lawyers FL Near Me
Tampa divorce attorneys & family lawyers. Top Tampa Florida law firm women attorneys for men & women. Free consultation. ⭐ TRUSTED since 1997. Se habla Español.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

pilka.com
Lakeland Florida Attorneys | Pilka Adams & Reed, P.A. | Brandon Florida
Contact Pilka Adams & Reed, P.A., in Brandon or Lakeland at 813-502-1097 to speak with our highly experienced attorneys. Friendly, efficient legal help.

Categories: Business, Business

Similar?
Yes 0 No 0

curryauto.com
Curry Automotive | New and Used Cars | Visit Us Today
Curry Automotive offers new and used Toyota vehicles, parts, service and financing to car buyers in Cortlandt Manor, Woodbury and Yorktown Heights

Moz DA: 24 Moz Rank: 3 Semrush Rank: 916,832 Facebook ♡: 22
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

affordablelegalfees.com
Affordable Legal Fees : Low Cost Lawyers in Tampa, Orlando FL
Our affordable Lawyers in Florida can help you when you need a lawyer for auto accidents, divorce, family law, DUIs, or personal injuries.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

escobarlaw.com
Criminal Defense Attorney Tampa, FL | DUI Defense
Call the experienced Tampa, Florida, criminal defense attorneys at Escobar, Michaels & Associates at 813-513-0274 for a free consultation.

Categories: Business, Web Hosting

Similar?
Yes 0 No 0

tampaflcriminaldefenselawyers.com
Criminal Defense Lawyer | St. Petersburg | The Law Office of Timothy Hessinger
The St. Petersburg criminal defense attorney at The Law Office of Timothy Hessinger is former prosecutor with 15+ years' experience. Free consultation!

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

brandonfamilylaw.com
Divorce and Family Law Attorneys | Brandon Family Law
Brandon Family Law 813-653-1744 Family Law Firm in Brandon Florida Focused on Divorce Adoption Estate Planning and Probate

Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

gatewaydivorcelaw.com
Affordable St. Louis Divorce Lawyers | Gateway Divorce & Family Law
Gateway Divorce Law is the law firm of McChesney & Ortwerth, fast, powerful, and affordable St. Louis, Missouri divorce and family lawyers.

Semrush Rank: 1,236,750
Categories: Business, Business

Similar?
Yes 0 No 0

mikeglaw.com
Criminal Defense Attorney Tampa, FL - Protect Your Rights | Mike G Law
Tampa criminal defense attorney and former prosecutor Mike G Law has over 25 years of experience protecting clients’ rights. Get your FREE consultation.

Semrush Rank: 104,652 Facebook ♡: 1,235
Categories: Computers/Software/Operating Systems, Business, Regional/North America, Business, Government and Legal Organizations

Similar?
Yes 0 No 0

defendtampa.com
Maj Vasigh | Tampa Criminal Defense Lawyer
When your future is on the line, you need the help of an experienced Tampa criminal defense lawyer who has your best interests at heart. Call Maj Vasigh today for a free consultation.

Categories: Business, Business

Similar?
Yes 0 No 0

chrislawyer.com
The Law Offices Of Chris Schmiedeke, PC | Divorce Simplified
We make the process simple. We help with issues regarding children & property. We try to answer your questions with simple answers. Divorce Simplified.

Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

hillsboroughdefense.com
Tampa Criminal Defense Attorney | Metcalf Falls, Criminal Defense Attorneys, P.A.
Charged with a crime in Tampa? Get Answers and Protect Yourself. Call Criminal Defense Attorney Brett Metcalf. Free Consults Avail: (813) 258-4800.

Facebook ♡: 52
Categories: Business, Business

Similar?
Yes 0 No 0

moonlawgroup.com
moonlawgroup.com - moonlawgroup Resources and Information.
moonlawgroup.com is your first and best source for all of the information you’re looking for. From general topics to more of what you would expect to find here, moonlawgroup.com has it all. We hope you find what you are searching for!

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

pallegarlawfirm.com
Tampa Criminal Defense Lawyer | Sarasota, Florida DUI Lawyer | Pallegar Law, P.A.
Free Consultation - Call (813) 444-3912 - Pallegar Law, P.A. aggressively represents the accused against charges in Criminal Defense & DUI cases.

Semrush Rank: 589,218
Categories: Business, Business

Similar?
Yes 0 No 0

criminalattorneytampa.net
Criminal Defense Attorney in Tampa, FL - Hanlon Law
Criminal Defense Attorney in Tampa, FL - Hanlon Law | Florida-based criminal defense law firm Hanlon Law is full of winning lawyers. We aggressively defended clients all across FL. Let us fight for you and help you win the fight. Visit our website or call us at (813) 228-7095 to schedule your consultation today!

Semrush Rank: 623,400
Categories: Business, Business

Similar?
Yes 0 No 0

pkwalaw.com
Award Winning Law Firm in Singapore - PKWA Law
PKWA Law is an established Singapore law firm offering legal services across the full spectrum of practice areas.

Semrush Rank: 1,247,647 Facebook ♡: 0
Categories: Business, Business

Similar?
Yes 0 No 0

Suggest Site to this list (currylawgroup.com)

Please only suggest if the website is similar. We do check suggested websites carefully and only approve if it's completely similar.

Site Url

Why do you think it is similar?

Email address We'll never share your email with anyone else. You'll get a confirmation email.

3 (times) seven

I'm sure it's similar Yes

currylawgroup.com Reviews

No reviews have been made yet.

What is sitelike.org?

sitelike.org is a free tool to search and find Similar Websites, alternatives or related to the given site.
It helps you to find similar sites based on keyword overlap and shared audience.
Our team is manually checking and finding similar websites and also our visitors are helping us to find the best similar websites.
"Similar sites like" first finds the best and top keywords for all websites and rank them.
We also use our internal algorithm with analysing the website contents and also several web sources to determine the main topics of websites which are used to find similar websites that have the closest matching set of topics. Our ranking system uses user generated content created by our team, our visitors and also our algorithm.