Similar sites like joynerlawfirm.com

Texas Law Firm | CDL Lawyer | Joyner + Joyner (210) 722-9089

Criminal defence law, traffic ticket law, personal injury law, CDL defense, and more. Call (210) 722-9089 to speak to a Texas law firm.

Categories: Business, Business
Topics: cdl lawyer, joyner (210) 722-9089, texas law firm

Semrush Rank: 964,429

joynerlawfirm.com Reviews

Sites similar to joynerlawfirm.com - Top 77 joynerlawfirm.com alternatives

sanantonioticketlaw.com
Joyner + Joyner, P.C. All rights reserved.
Joyner + Joyner, P.C. All rights reserved.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

ticketlawyersanantonio.com
San Antonio Traffic Ticket Lawyers | San Antonio Traffic Ticket Lawyers
San Antonio Traffic Ticket Lawyers | San Antonio Traffic Ticket Lawyers

Semrush Rank: 3,443,054
Categories: Business, Business

Similar?
Yes 0 No 0

trafficticketssanantonio.com
Traffic Violation - Traffic Ticket Attorney San Antonio | The Slade Law Firm
Traffic Ticket Attorney Gordon Slade will work diligently to get your Traffic Violation dismissed. If you have a traffic violation call The Slade Law Firm

Semrush Rank: 6,413,188
Categories: Business, Business

Similar?
Yes 0 No 0

hop-law.com
Texas Law Firm | Legal Representation Services | Heygood, Orr & Pearson
Business Litigation, Personal Injury Lawyers | Dallas, Texas - Heygood, Orr & Pearson. | Real Trial Lawyers for Real Solutions

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

traceyfoxlaw.com
San Antonio Personal Injury Lawyers : Texas Law Firm : Tracey Fox King & Walters
If you’ve been injured in a serious accident, let a San Antonio personal injury lawyer fight to get you maximum compensation. Call our San Antonio office for a free consultation.

Categories: Marketing/Merchandising, Shopping

Similar?
Yes 0 No 0

hvwlaw.com
Texas Law Firm | Estate Planning Business and Tax Planning Charitable Foundations Related Legal Expertise
Texas Law Firm | Estate Planning Business and Tax Planning Charitable Foundations Related Legal Expertise

Semrush Rank: 3,402,288
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

skwtexas.com
Dallas Family Law Attorneys - Texas Law Firm | Sullivan, Klocke & Williamson P.C.
Families in Dallas and throughout Texas turn to the family law attorneys at Sullivan, Klocke & Williamson P.C. for help with their divorce. Learn More.

Categories: Business, Business

Similar?
Yes 0 No 0

gdigbylaw.com
Texas Law Firm | Texas Divorce Attorney | Texas Probate Attorney @ gdigbylaw.com
Texas law firm serving you for Family, Business, Construction, Real Estate law with offices in Collin County, Dallas & Denton.

Semrush Rank: 18,874,679
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

perryjcockerell.com
Perry Cockerell, P.C. | Dallas, Texas Law Firm
Perry Cockerell, P.C. is a Dallas, Texas law firm focused on real estate disputes, title insurance defense and a range of trial and appellate litigation.

Semrush Rank: 42,014,050
Categories: Blogs/Wiki, Business

Similar?
Yes 0 No 0

perrycockerell.com
Perry Cockerell, P.C. | Dallas, Texas Law Firm
Perry Cockerell, P.C. is a Dallas, Texas law firm focused on real estate disputes, title insurance defense and a range of trial and appellate litigation.

Semrush Rank: 6,462,189
Categories: Business, Business

Similar?
Yes 0 No 0

dallasarealaw.com
MAS Law | Lawyers on Your Side®
At MAS Law, we fight on the side of our clients. With decades of experience and free consultations, we can improve your chances of a favorable outcome. Call today.

Facebook ♡: 0
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

hossleyembry.com
Texas Law Firm - Hossley & Embry
Texas Law Firm - Hossley & Embry

Semrush Rank: 3,446,487
Categories: Education/Reference, Government and Legal Organizations

Similar?
Yes 0 No 0

wmbwaco.com
Witt, McGregor, Bourland, P.L.L.C. » A Waco, Texas Law Firm
Witt, McGregor, Bourland, PLLC is a Texas law firm based in Waco. WMB serves the Central Texas region with a goal of excellent, client-based results.

Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

lkclawfirm.com
Leger Ketchum & Cohoon, PLLC – Texas Attorney | Texas Law Firm
LKC is a litigation and business law firm with offices in Dallas, the Woodlands, and Boerne TX. Looking for legal advice? Better Call LKC! 888 508 6005

Semrush Rank: 2,330,822
Categories: Business, Business

Similar?
Yes 0 No 0

texasdentistlawyer.com
Law firm in Houston Texas | Dentist Lawyer | Texas Law Firm - Huynh and Huynh
Looking for best attorney at law in Houston TX? We assist small businesses, healthcare, asset protection, estate tax planning & property law.

Semrush Rank: 3,619,296
Categories: Business

Similar?
Yes 0 No 0

mehryarilaw.com
HOME - Mehryari Law: Dallas, Texas Law Firm
HOME - Mehryari Law: Dallas, Texas Law Firm

Semrush Rank: 3,496,447

Similar?
Yes 0 No 0

dittfurthlaw.com
Dittfurth Law Group, PLLC - A San Antonio, Texas Law Firm
Dittfurth Law Group, PLLC - A San Antonio, Texas Law Firm

Semrush Rank: 25,409,131
Categories: Business, Business

Similar?
Yes 0 No 0

trafficticketsa.com
Traffic Ticket San Antonio | Fight Your Traffic Citations or Your Money Back
We Fight Traffic TicketSo You Don’t Have ToWE FIGHT YOUR TRAFFIC TICKETSClick to Call 210-745-2825TRAFFIC TICKET HELP Fill out the form below to get started.WE FIGHT YOUR TRAFFIC TICKETSClick to Call 210-745-2825TRAFFIC TICKET HELP Fill out the form below to get started.FLAT FEE$ 150*COURT COSTSCOURT COSTS $ 150 +Reduce Fine or ProbationClear Driving RecordDefensive […]

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

morrisdewett.com
Louisiana & Texas Personal Injury Law Firm | Morris & Dewett Injury Lawyers
Our top-rated Louisiana and Texas personal injury attorneys are dedicated to working tirelessly to help our clients pursue fair financial compensation for their injuries. Free consultation; call today!

Semrush Rank: 649,721
Categories: Business, Business

Similar?
Yes 0 No 0

foresterhaynie.com
Texas Law Firm, Nationwide Results - Forester Haynie

Semrush Rank: 2,535,376
Categories: Business, Business

Similar?
Yes 0 No 0

aminiconant.com
Amini & Conant | Texas Law Firm | Lawyering for Humans
Amini & Conant is an innovative Texas law firm providing litigation and transactional services for businesses and individuals.

Facebook ♡: 0
Categories: Business, Personal Websites and Blogs

Similar?
Yes 0 No 0

smcesq.com
Shann Chaudhry, Esq. Attorney at Law | Texas Law Firm
SMC, ESQ is a boutique law firm serving Austin & San Antonio. We specialize in Business, Estates & Trusts, Mediation, Real Estate, Bankruptcy, & Elder Law.

Semrush Rank: 6,491,733
Categories: Business, Business

Similar?
Yes 0 No 0

dallascriminaldefenselawfirm.com
Dallas Criminal Defense Lawyers | Texas Criminal Defense Attorneys | Dallas, Texas Law Firm
Our Dallas criminal defense lawyers represent people who have been charged with criminal offenses in Dallas, Texas.

Facebook ♡: 0
Categories: Business, Newly Observed Domain

Similar?
Yes 0 No 0

jenkinswatkins.com
Jenkins & Watkins, P.C. - Dallas, Texas Law Firm | Labor & Employment, Business and Commercial Litigation, and Business and Corporate Law
Jenkins & Watkins, P.C. has more than 90 years of combined experience handling labor and employment, commercial litigation and corporate law matters.

Semrush Rank: 5,875,261
Categories: Business, Business

Similar?
Yes 0 No 0

foreclosureattorney.com
24-7 Legal Documents From Home | 24-7 Legal Documents | Texas Law Firm | Texas
24-7 Legal Documents From Home, a texas law firm located in Texas serving all who own an interest in Texas real estate.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

texaslawyeronline.com
24-7 Legal Documents From Home | 24-7 Legal Documents | Texas Law Firm | Texas
24-7 Legal Documents From Home, a texas law firm located in Texas serving all who own an interest in Texas real estate.

Categories: Business

Similar?
Yes 0 No 0

raytaylorlaw.com
San Antonio Criminal Defense Lawyer | Drug Crime Attorney | Texas Law Firm
Contact a San Antonio criminal defense lawyer today at the Law Offices of Ray Taylor & Associates, P.C. Call for a free initial consultation at (210) 807-9916.

Categories: Business

Similar?
Yes 0 No 0

texasticketlawyer.com
Texas Ticket Lawyer | Texas Ticket Attorney
texas traffic ticket attorney | texas traffic ticket lawyer | Handing tickets throughout the great state of Texas

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

texasticketbusters.com
Let Us Help You Drive Legally
Traffic Ticket Attorney Georgetown Tx-Let Us Help You Drive Legally with an Experienced Traffic Ticket Lawyer in Georgetown Tx. Speeding Ticket Lawyer Georgetown Tx

Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

dwilegaldefense.com
Attorney, legal advice, traffic ticket defense, Montgomery Country, Texas | Robert Markowitz lawyer
Call Montgomery, Texas attorney Robert Markowitz for legal advice in traffic ticket defense, DWI, and license suspension.

Semrush Rank: 1,788,325
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

douglasatkinson.com
Texas Criminal Defense Lawyer | Criminal Lawyer Serving Texas
If you are facing criminal charges, for a free consultation, contact Conroe criminal defense attorney Douglas W. Atkinson. Learn how his respected law firm could help get your charges dropped!

Semrush Rank: 1,157,199
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

ccbeachlawyer.com
Experienced Criminal Defense Lawyer in Corpus Christi and South TX
Professional criminal defense lawyer Phillip Goff is a dedicated Texas attorney who defends clients in Corpus Christi, Laredo, Brownsville, Hidalgo, and all of South Texas.

Semrush Rank: 42,901,019
Categories: Business, Business

Similar?
Yes 0 No 0

coquatlawfirm.com
San Antonio Probate Lawyer | 210-745-2000 | The Coquat Law Firm |
[mobile friendly] Free Consult 210-745-2000. Justin A. Coquat, The Coquat Law Firm, San Antonio wills, San Antonio Probate Lawyer San Antonio wills.

Moz DA: 18 Moz Rank: 3.1 Semrush Rank: 4,161,264 Facebook ♡: 21
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

elpasotrafficticket.com
Traffic Ticket Lawyer El Paso - Warrant Attorney Robert Navar Call Today!
Traffic Ticket Attorney. I Can Help With Traffic Warrants From The El Paso Municipal Court And Justice Of The Peace. Call For A Free Consultation Hablamos Espanol

Semrush Rank: 570,641
Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

abramdefense.com
Delaware Criminal Defense Firm
At Abram and Hutchison, our Delaware criminal defense attorney is available 24/7. Call now to get started with your FREE consultation!

Semrush Rank: 3,513,234
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

anthonycantrell.com
San Antonio Criminal Attorney | DWI, Drug Crimes, Assault
Call The Law Office of Anthony Cantrell at 866-604-7814 for a skilled San Antonio criminal lawyer, including DWI defense, drug crimes, assault & federal charges

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

hawkinswalker.com
Hawkins Walker, PC
Hawkins Walker, PC

Semrush Rank: 785,960
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

txattorney.us
Abilene & San Angelo Criminal Defense Lawyer | Law Offices of David M. White
The Law Offices of David M. White provides criminal & personal injury representation to people in Abilene, San Angelo, and the surrounding areas. Free consult!

Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

jasonenglishlaw.com
Criminal Defense Lawyer in Austin Texas | Jason English
Criminal Defense Lawyer in Austin Texas | Jason English

Semrush Rank: 736,625
Categories: Business, Business

Similar?
Yes 0 No 0

rhinolawyers.com
🦏 Auto Accident Lawyers | RHINO Lawyers | Injured or Arrested?
Injured in an auto accident or arrested? Partner with RHINO Lawyers today and we promise you will never be just another case.

Semrush Rank: 466,187
Categories: Business, Business

Similar?
Yes 0 No 0

roadmanespiritu.com
Criminal Defense & DWI Attorneys in Austin, TX and Travis County
Charlie Roadman and Mary Ann Espiritu are DWI lawyers and criminal defense attorneys in Austin, Texas and Travis County. We offer 30+ years of criminal defense experience in DWI, misdemeanors, and felony cases. Contact our Austin law office today.

Semrush Rank: 1,281,963
Categories: Business, Business

Similar?
Yes 0 No 0

monkslaw.com
Monks Law Firm | Home | Houston Defense + Ticket Lawyers
Mike and Pat Monks are experienced, proven Houston attorneys with over 70 years of combined experience fighting for clients in a wide range of practice areas.

Semrush Rank: 1,980,425
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

trafficticketlawyerelpaso.com
Traffic Ticket Lawyer El Paso, TX Warrant Attorney Robert Navar
Traffic Ticket Lawyer or Warrants no problem, we can help. Call my office for a free consultation 915-613-3993. I handle all types of violations including animal control tickets.

Semrush Rank: 5,624,653
Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

roadlaw.net
Truck Driver Lawyers | Road Law | Call 888-276-8000
Hire truck driver lawyers at Road Law. We also offer help with CDL speeding tickets and more. Visit our site to learn more about our attorneys today.

Semrush Rank: 3,186,631
Categories: Finance/Banking, Government and Legal Organizations

Similar?
Yes 0 No 0

randyalpertlaw.com
Queens NY Traffic Violations Lawyer | Nassau County DWI Attorney
Contact New York traffic defense and criminal defense attorney Randy S. Alpert. Call 718-557-9748 or 516-231-9903.

Semrush Rank: 2,258,306
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

grandprairietrafficticketlawyer.com
Grand Prairie Traffic Ticket Lawyer | Warrants Lifted Attorney Texas |
Grand Prairie Traffic Ticket Lawyer | Warrants Lifted Attorney Texas |

Categories: Marketing/Merchandising, Newly Observed Domain

Similar?
Yes 0 No 0

beltzlaw.com
Beltz Law Firm | Dallas Traffic Ticket, Accident & Criminal Attorney
Beltz Law Firm is a top rated Dallas Law Firm. We provide legal services for injury cases, traffic tickets, criminal defense, and DUI as well as DWI.

Moz DA: 22 Moz Rank: 3.7 Semrush Rank: 637,049
Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

mytraffictickets.com
Best Traffic Ticket Dismissal Lawyers - MyTrafficTickets.com
My Traffic Tickets, a one-stop destination to take care of all traffic ticket needs with only the best customer service. Call us for Traffic Tickets Lawyers!

Semrush Rank: 682,395
Categories: Business, Business

Similar?
Yes 0 No 0

perkinslawcolorado.com
Colorado Springs Criminal Defense & Family Law Attorney
Bryson Perkins is a criminal defense lawyer and divorce attorney in Colorado Springs. Put your defense in experienced hands. Proven results. Free consultations.

Semrush Rank: 1,732,683
Categories: Business, Business

Similar?
Yes 0 No 0

harberlaw.com
Dallas DWI Lawyer | Former Prosecutor | The Law Office Of RJ Harber
Accused of a DWI or DUI in Dallas? Attorney RJ Harber is a Former Prosecutor who knows what it takes to win. Call for a Free Consultation.

Semrush Rank: 1,176,928
Categories: Business, Business

Similar?
Yes 0 No 0

driverslegalplan.com
Commercial Truck Drivers Legal Plan | CDL protection for less than .45 a day
Call 1-800-417-3552 to reduce the detrimental effects of truck driver 'safety events' upon your trucking company’s Safety Rating and/or Inspection Selection Number

Moz DA: 24 Moz Rank: 3.5 Semrush Rank: 238,263 Facebook ♡: 57
Categories: Education/Reference, Government and Legal Organizations

Similar?
Yes 0 No 0

thetrafficticketman.com
www.thetrafficticketman.com
www.thetrafficticketman.com

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

beltzlawyer.com
Beltz Lawyer
Dallas Beltz Lawyer

Categories: Business, Newsgroups and Message Boards

Similar?
Yes 0 No 0

mesquitetrafficticketlawyer.com
Mesquite Traffic Ticket Lawyer | Mesquite Speeding Attorney
We are Mesquite traffic ticket attorneys that assist clients in the DFW area with all types of cases, which include speeding tickets, warrants, suspended

Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

interstatetrucker.com
Nationwide CDL Lawyer and Ticket Defense - Interstate Trucker
CDL Lawyers For Any Reason, In Any State. Call 800-333-DRIVE to speak to an experienced CDL Traffic Ticket Lawyer

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

dallas-trafficticketlawyer.com
Dallas Traffic Ticket Lawyers | Dallas Ticket Attorneys | Affordable Legal Representation In Dallas For Those Accused Of Traffic, Misdemeanor, & Municipal Ordinance Violations
Dallas Traffic Ticket Dismissal From $40. Discounts For Multiple Tickets. 214 575 6060 for more information. Our Ticket Lawyers Lift Dallas Warrants Too.

Semrush Rank: 1,482,058
Categories: Marketing/Merchandising, Political Organizations

Similar?
Yes 0 No 0

carabinshaw.com
San Antonio Texas Personal Injury Lawyer | Corpus Christi Auto Accident Attorney | Carabin Shaw
Free Consultation - Carabin Shaw is available day or night to speak with you. Experienced lawyers in auto & motorcycle accidents, wrongful death, product liability, personal injury accidents, construction accidents, animal attacks, and social security disability claims.

Moz DA: 31 Moz Rank: 4.5 Semrush Rank: 206,839
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

keateslawfirm.com
DWI, Drug, Theft Defense Lawyer
Austin Attorney for DWI, Assault, Drug Defense, 16+ Years Experience defending Felony and Misdemeanor Arrests - Keates Law Firm - Travis County Lawyer

Semrush Rank: 1,388,664
Categories: Business, Business

Similar?
Yes 0 No 0

sanantoniocriminaldefense.com
San Antonio DWI Lawyer | San Antonio Criminal Defense Attorney | Austin DWI Seguin Texas | Law Offices of Sam H. Lock
San Antonio, Texas Criminal Defense Attorney Sam H. Lock represents clients in a variety of criminal cases, focusing on DWI, Federal Crimes, White Collar Defense, DWI/DUI Offenses and various other Felonies and Drug Offenses. He also helps clean up criminal records for people through the Expunction Process. Call today for a free consultation.

Categories: Business, Business

Similar?
Yes 0 No 0

kctrafficlawyer.com
Traffic Lawyer in Kansas City | The KC Traffic Lawyer
Timothy R. Tompkins, the KC Traffic Lawyer, has represented clients in courts all around the Kansas City metropolitan area. He can help you, too.

Semrush Rank: 1,248,650
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

omnibase.com
OmniBase Services
OmniBase, #failure to appear

Semrush Rank: 3,940,424
Categories: Government/Military, Government and Legal Organizations

Similar?
Yes 0 No 0

trafficlawyersoftexas.org
Traffic Lawyers of Texas
Traffic Lawyers of Texas.

Semrush Rank: 2,978,159
Categories: Business, Business

Similar?
Yes 0 No 0

ericramoslaw.com
San Antonio Personal Injury Lawyer - Eric Ramos Law, PLLC - (210) 404-4878
Eric Ramos is a San Antonio personal injury lawyer who helps Texans recover physically & financially after an injury. Free consultation. No fee unless we win. Call (210) 404-4878 Today!

Semrush Rank: 3,511,322
Categories: Business, Business

Similar?
Yes 0 No 0

attorneyprime.com
Texas Family Law Attorneys | Attorney Prime
Top Texas attorneys will review your case, draft your court documents, and provide everything you need to handle your case. Welcome to the future of legal.

Categories: Business, Business

Similar?
Yes 0 No 0

theticketattorney.com
Houston Traffic Ticket Attorney - Eutsler Law Firm
Robert Eutsler has been providing affordable traffic ticket defense for all types of violations for over 15 years. For a free consultation call 713-464-6461.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

jackbynoattorney.com
Dallas-Fort Worth Traffic Ticket Attorney | Traffic Court, DWI, License Suspension
Have you been cited for a traffic violation in the Dallas-Fort Worth area? Call an attorney at Jack Byno & Associates at 817-685-0912. Representing DFW clients everywhere, including Arlington, Frisco, Irving, Denton, Mesquite and Allen, TX.

Facebook ♡: 0
Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

traylorlawfirm.com
Criminal Defense Attorney in Dallas, TX | Traylor Law Firm
Dallas, TX Criminal Defense Attorney | Have you been charged with a crime? | Are you being questioned by police? | Have you been arrested and need help? | Call Traylor Law Firm to protect your rights!

Semrush Rank: 1,410,970
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

springfieldtraffictickets.com
Springfield Traffic Tickets: Traffic Ticket Attorney in Springfield, MO
If you've received a traffic citation, let an experienced traffic ticket attorney in Springfield, MO represent you in court. Our traffic ticket lawyers can help keep points from appearing on your license so you can get back on the road. We can even appear in court on your behalf.

Semrush Rank: 1,175,915
Categories: Business, Business

Similar?
Yes 0 No 0

octicketdefense.com
Orange County Traffic Ticket Defense Lawyer Scott R. Ball. Rated #1 traffic ticket attorney in California!
Traffic Ticket Defense attorney, Scott R. Ball. 100% OF MY PRACTICE is traffic ticket defense in Orange County, CA. 100% OF MY BUSINESS PLAN is providing the best Customer Service I can humanly deliver.

Semrush Rank: 726,857
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

ticketattorneydallas.com
Dallas Texas Traffic Ticket Attorneys | Anderson & Anderson
Learn more about our traffic ticket attorney services and contact us for a consultation, we can take your call in English, Spanish, or French at (214) 370-8260.

Categories: Business, Political Organizations

Similar?
Yes 0 No 0

chambers-law.com
Austin Criminal Defense Attorney | Travis County Lawyer
We have 25 years of proven results, obtaining DISMISSALS on some of the most difficult criminal cases in Austin, Texas. Criminal offenses we can help you with: DWI/DUI, assault charges, domestic violence, drug offenses, driving while license suspended, theft, probation revocation, or any misdemeanor and felony.

Semrush Rank: 1,140,871 Facebook ♡: 378
Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

kcticketlaw.com
Traffic Lawyer | Speeding | DUI | Criminal Defense Attorney
Our Kansas City traffic lawyers & speeding ticket attorneys assist with speeding & traffic tickets, DUI, and criminal law violations in Kansas & Missouri.

Facebook ♡: 0
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

speedingticketkc.com
Home - Speeding Ticket KC-Traffic Lawyers In Kansas City
Traffic Lawyers In Kansas City Handling Traffic Tickets.kansas city traffic lawyers,traffic lawyer kansas city,traffic lawyer kansas city mo.

Facebook ♡: 0
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

kuboshlaw.com
Paul Kubosh, Attorney at Law | Harris County Traffic Ticket Lawyers
Pulled over? Arrested? Trust our Harris County traffic ticket attorneys at the office of Paul Kubosh, Attorney at Law for a free consultation.

Semrush Rank: 378,511
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

drivelegaltx.com
Stefanie Collins Attorney at Law
Stefanie Collins Attorney at Law

Semrush Rank: 2,396,705
Categories: Business, Business

Similar?
Yes 0 No 0

criminaldefenseattorneyplano.com
Starr Law, P.C. | Criminal Defense Attorney | Plano & Mckinney
Have you been accused of a crime? Contact Attorney Kent Starr of Starr Law, P.C. to aggressively fight your charges today in McKinney and Plano!

Semrush Rank: 1,153,057
Categories: Business, Business

Similar?
Yes 0 No 0

novadefenders.com
Fairfax County Criminal Defense Lawyer | Fairfax, Virginia DUI Attorney | S&R Law Firm
Free Consultation - At S&R Law, our criminal defense lawyers are committed to giving you peace of mind and delivering positive results.

Semrush Rank: 380,346
Categories: Business, Business

Similar?
Yes 0 No 0

Suggest Site to this list (joynerlawfirm.com)

Please only suggest if the website is similar. We do check suggested websites carefully and only approve if it's completely similar.

Site Url

Why do you think it is similar?

Email address We'll never share your email with anyone else. You'll get a confirmation email.

3 (times) seven

I'm sure it's similar Yes

joynerlawfirm.com Reviews

No reviews have been made yet.

What is sitelike.org?

sitelike.org is a free tool to search and find Similar Websites, alternatives or related to the given site.
It helps you to find similar sites based on keyword overlap and shared audience.
Our team is manually checking and finding similar websites and also our visitors are helping us to find the best similar websites.
"Similar sites like" first finds the best and top keywords for all websites and rank them.
We also use our internal algorithm with analysing the website contents and also several web sources to determine the main topics of websites which are used to find similar websites that have the closest matching set of topics. Our ranking system uses user generated content created by our team, our visitors and also our algorithm.