Similar sites like markjobrien.com

Tampa Criminal Defense Lawyer | O'Brien Hatfield, P.A.

Superb 5.0 rated criminal defense attorneys. Tampa, Florida-based law firm O’Brien Hatfield, P.A. Available 24/7 Call 813-440-2347 for a free, private case review.

Categories: Sports, Government and Legal Organizations
Topics: 18 usc 3553, age of consent in florida, mark o'brien lawyer, o'brien hatfield, o'brien hatfield reese, tampa criminal defense lawyer, us extradition lawyer, youthful offender

Semrush Rank: 416,417 Facebook ♡: 66

markjobrien.com Reviews

Sites similar to markjobrien.com - Top 72 markjobrien.com alternatives

tampabaylegalservices.com
Tampa Criminal Attorney | Tampa Criminal Defense Lawyer
Affordable Tampa Criminal Defense Attorney that is experienced and will work for you. We focus on criminal defense law in Tampa Bay Florida. Call us today for a free consultation (813) 857-8237

Categories: Business, Business

Similar?
Yes 0 No 0

gilschaffnit.com
Gainesville Criminal Defense Lawyer
Gainesville criminal defense lawyer Gilbert A. Schaffnit helps with Florida s*x crimes, drug charges, weapons offense, violent crimes, theft, DUI & more.

Semrush Rank: 518,226
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

tampacriminalattorneys.com
Tampa Criminal Defense & DUI Lawyers | Thomas & Paulk
Get a FREE case evaluation with Tampa criminal defense & DUI attorneys at Thomas & Paulk. Thousands of cases handled. Decades of experience. Available 24/7!

Moz DA: 26 Moz Rank: 3.3 Semrush Rank: 366,793
Categories: Business, Business

Similar?
Yes 0 No 0

communitylawfirm.com
Daytona Beach Lawyers | Aaron Delgado & Associates
Experienced Daytona Beach Criminal Defense Lawyers, DUI Lawyers, and Family Lawyers. We’re here to help you 24/7. Flexible Lawyer Payment Plans.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

mikeglaw.com
Criminal Defense Attorney Tampa, FL - Protect Your Rights | Mike G Law
Tampa criminal defense attorney and former prosecutor Mike G Law has over 25 years of experience protecting clients’ rights. Get your FREE consultation.

Semrush Rank: 104,652 Facebook ♡: 1,235
Categories: Computers/Software/Operating Systems, Business, Regional/North America, Business, Government and Legal Organizations

Similar?
Yes 0 No 0

justiceflorida.com
Criminal Defense Lawyer West Palm Beach | Call Today (561) 832-4348
Looking for a criminal defense lawyer in West Palm Beach? Criminal lawyer Ron Chapman helps those accused of DUI, Drug crimes and s*xual offenses.

Facebook ♡: 0
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

saratoganewyorkdwilawyer.com
Saratoga NY Criminal Lawyer | Albany DWI Attorney | James F. Hughes
Free Consultation - 24/7 - Call (888) 371-1299 - James F. Hughes aggressively represents the accused against charges in Criminal & DWI cases.

Semrush Rank: 1,757,205
Categories: Business, Business

Similar?
Yes 0 No 0

tampafloridacriminallawyer.com
Tampa Criminal Lawyer | Hillsborough County Criminal Defense Attorney | The Mayberry Law Firm
Free Consultation - Call (813) 444-7435 - The Mayberry Law Firm aggressively represents the accused against charges in Criminal & Criminal Defense cases.

Semrush Rank: 902,556
Categories: Sports, Business

Similar?
Yes 0 No 0

goldmanwetzel.com
Criminal Defense Attorneys St. Petersburg, FL | Goldman Wetzel
Facing criminal charges? Early legal intervention is critical! St. Petersburg criminal attorneys Goldman Wetzel can help: 727-828-3900.

Semrush Rank: 530,639
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

criminalattorneytampa.net
Criminal Defense Attorney in Tampa, FL - Hanlon Law
Criminal Defense Attorney in Tampa, FL - Hanlon Law | Florida-based criminal defense law firm Hanlon Law is full of winning lawyers. We aggressively defended clients all across FL. Let us fight for you and help you win the fight. Visit our website or call us at (813) 228-7095 to schedule your consultation today!

Semrush Rank: 623,400
Categories: Business, Business

Similar?
Yes 0 No 0

famm.org
Homepage - FAMM
Homepage - FAMM

Moz DA: 61 Moz Rank: 5.3 Semrush Rank: 113,408 Facebook ♡: 850
Categories: Non-Profit/Advocacy/NGO, General Organizations

Similar?
Yes 0 No 0

cnycriminallawyers.com
Syracuse Criminal Defense Lawyer | New York Attorney
Crime is an ugly word. When you stand accused, work with Syracuse attorney Michael Spano at 315-350-3975. Do not delay!

Categories: Business, Business

Similar?
Yes 0 No 0

escobarlaw.com
Criminal Defense Attorney Tampa, FL | DUI Defense
Call the experienced Tampa, Florida, criminal defense attorneys at Escobar, Michaels & Associates at 813-513-0274 for a free consultation.

Categories: Business, Web Hosting

Similar?
Yes 0 No 0

phila-criminal-lawyer.com
Philadelphia Criminal Defense Lawyer | Professional License Defense
Hark and Hark of Philadelphia, Pennsylvania, provides federal criminal representation. Call 877-4-HARK-LAW for a consultation.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

romanromanlaw.com
Clearwater Personal Injury Attorney
The Clearwater personal injury attorneys of Roman & Roman are highly experienced and dedicated to helping our clients.

Categories: Business, Business

Similar?
Yes 0 No 0

timbowerrodriguez.com
Tim Bower Rodriguez, PA | Florida Federal Defense Attorney
Tim Bower Rodriguez, PA is a federal defense attorney for those accused of serious federal crimes in jurisdictions throughout Florida and Puerto Rico.

Semrush Rank: 1,683,889

Similar?
Yes 0 No 0

arensteinlaw.com
Cincinnati Criminal Defense Lawyer | Federal Crimes
We provide assertive criminal defense services to individuals in Cincinnati and the surrounding area. We also handle federal cases. 513-823-3012

Semrush Rank: 1,338,097
Categories: Business, Business

Similar?
Yes 0 No 0

tpatrialattorneys.com
Tampa, FL Criminal Defense | DUI Attorney | Federal Lawyer
Free consultation at Stechschulte Nell for Federal, DUI, s*x, assault, drug crime charges. Call our board certified Tampa, Florida criminal defense lawyer.

Categories: Business, Business

Similar?
Yes 0 No 0

davidolsonlaw-firm.com
Criminal Defense Attorney West Palm Beach | Home | David Olson Law
Criminal Defense Attorney West Palm Beach | Home | David Olson Law

Semrush Rank: 727,718 Facebook ♡: 862
Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

geoffreygnathanlaw.com
Top Boston Massachusetts Criminal & Federal Defense Lawyer || Geoffrey G Nathan Law Offices
Attorney Geoffrey Nathan is a top criminal defense attorney in Massachusetts. He is a nationally ranked criminal defense lawyer and has 20+ years of experience.

Semrush Rank: 1,471,760 Facebook ♡: 136
Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

pallegarlawfirm.com
Tampa Criminal Defense Lawyer | Sarasota, Florida DUI Lawyer | Pallegar Law, P.A.
Free Consultation - Call (813) 444-3912 - Pallegar Law, P.A. aggressively represents the accused against charges in Criminal Defense & DUI cases.

Semrush Rank: 589,218
Categories: Business, Business

Similar?
Yes 0 No 0

jgcrimlaw.com
Orlando Criminal Defense Lawyer | Orange County DUI Attorney | Law Offices of John P. Guidry
Free Consultation - Call (407) 423-1117 - The Law Office of John Guidry aggressively represents the accused against charges in Criminal Defense & DUI cases.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

yourtampacriminallawyer.com
Tampa Criminal Attorney | Criminal Defense Lawyer Tampa, FL
Need a local Tampa Criminal Attorney In Florida? We Fight Criminal Charges, Thousands Of Cases Handled. Criminal Defense Lawyer In Tampa

Categories: Business, Business

Similar?
Yes 0 No 0

thehardylawfirm.com
thehardylawfirm.com
Sucuri WebSite Firewall - Access Denied

Semrush Rank: 599,241
Categories: Marketing/Merchandising, Political Organizations

Similar?
Yes 0 No 0

frankrubino.com
Federal Criminal Attorney Miami, FL | White Collar Defense
The Miami federal defense attorneys at Frank A. Rubino, Esq., provide criminal defense representation throughout Florida, the U.S. and worldwide. 866-718-3994.

Moz DA: 30 Moz Rank: 3.2 Semrush Rank: 592,447
Categories: Education/Reference, Government and Legal Organizations

Similar?
Yes 0 No 0

sentencingcases.com
Welcome to Federal Sentencing Cases
Welcome to Federal Sentencing Cases

Semrush Rank: 3,947,774
Categories: Public Information, Business

Similar?
Yes 0 No 0

hubbslawfirm.com
Miami Lawyers | Hubbs Law Firm
If you need assistance with a criminal defense or immigration matter, contact Hubbs Law Firm to speak to an experienced & aggressive Miami attorney. We genuinely care about you & your future.

Semrush Rank: 529,578
Categories: Business, Business

Similar?
Yes 0 No 0

rflawgroup.com
Miami Criminal Lawyer
Miami criminal lawyers, Ratzan & Faccidomo, provide aggressive representation and will act fast to protect your rights and build a strong defense.

Semrush Rank: 528,814
Categories: Business, Business

Similar?
Yes 0 No 0

thehoffmanfirm.net
Miami Criminal Defense Lawyer | The Hoffman Firm
Were you charged with a crime? Put decades of experience on your side by calling the Miami criminal defense lawyer at The Hoffman Firm for a free consultation.

Moz DA: 24 Moz Rank: 3.1 Semrush Rank: 665,138
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

defendtampa.com
Maj Vasigh | Tampa Criminal Defense Lawyer
When your future is on the line, you need the help of an experienced Tampa criminal defense lawyer who has your best interests at heart. Call Maj Vasigh today for a free consultation.

Categories: Business, Business

Similar?
Yes 0 No 0

thelawman.net
Orlando Criminal Defense Attorney | The Umansky Law Firm
The Orlando criminal defense attorneys at The Umansky Law Firm handle all types of criminal charges. Free case review! Call us today at 407-228-3838.

Facebook ♡: 4
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

thefernandezlawgroup.com
Fernandez Law Group: Tampa Lawyers & Attorneys at Law
Fernandez Law Group Tampa Lawyers & Attorneys at Law: Personal Injury, Criminal Defense, DUI & Traffic Violations. FREE Consultations. 813-489-3222

Semrush Rank: 1,455,969
Categories: Business, Political Organizations

Similar?
Yes 0 No 0

pumphreylawfirm.com
Criminal Defense Attorney | DUI Lawyers in Tallahassee | Pumphrey Law
Find experienced criminal defense and DUI lawyers in Tallahassee and Leon County, FL, at Pumphrey Law. Our lawyers fight felony, misdemeanor and DUI charges.

Semrush Rank: 218,892
Categories: Business, Business

Similar?
Yes 0 No 0

indianafederaldefender.org

Home - Indiana Federal Community Defenders

Home - Indiana Federal Community Defenders

Semrush Rank: 2,933,847
Categories: Business, Business

Similar?
Yes 0 No 0

narsol.org
Home Page - NARSOL
Home Page - NARSOL

Semrush Rank: 477,469 Facebook ♡: 995
Categories: Blogs/Wiki, Government and Legal Organizations

Similar?
Yes 0 No 0

richardhornsby.com
Orlando Criminal Defense Attorney Richard Hornsby
Orlando criminal defense lawyer Richard Hornsby (407-540-1551) represents criminal defense, DUI, and juvenile clients in Central Florida and the greater Orlando area.

Moz DA: 47 Moz Rank: 3.9 Facebook ♡: 0
Categories: Non-Profit/Advocacy/NGO, Government and Legal Organizations

Similar?
Yes 0 No 0

miamicriminaldefenselaw.com
Swartz Law Firm
Consultation - Call (305) 579-9090 - Swartz Law Firm aggressively represents the accused against charges in Federal Criminal & Criminal Defense cases.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

jeffweiner.com
Miami Criminal Defense Lawyers | Jeffrey S. Weiner, P.A.
Find the best Miami criminal defense attorneys at Jeffrey S. Weiner, P.A. Recognized as top-rated criminal defense lawyers in Florida. Contact us today!

Categories: Education/Reference, Government and Legal Organizations

Similar?
Yes 0 No 0

yourtampalawyer.com
Tampa Criminal Attorney | FL Criminal Lawyer | Caimano Law Firm P.A.
When you need a Tampa criminal attorney, Caimano Law Firm, P.A. is the right place to call for quality representation.

Semrush Rank: 5,006,157
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

suarezlawfirm.com
Ed Suarez : Tampa's Top White Collar Criminal Defense Attorney
In a world full of lawyers, you will rarely find trial attorneys as capable, approachable, and committed to their clients as Ed Suarez and Rachel May Zysk. Our attorneys have successfully represented clients in state and federal courts throughout Florida and elsewhere.

Semrush Rank: 3,709,864
Categories: Business, Business

Similar?
Yes 0 No 0

morrisfirmpensacola.com
Pensacola Criminal Defense Attorneys | The Morris Firm
If you are facing serious changes in the State of Florida, contact the Pensacola criminal defense attorneys of The Morris Firm to hire experienced legal representation!

Categories: Business, Business

Similar?
Yes 0 No 0

thefllawfirm.com
Spring Hill and Brooksville Injury Attorney | Hernando County, Florida Criminal Lawyer | Whittel & Melton
Call 866-608-5529 - Whittel & Melton is dedicated to serving our clients with a range of legal services including Injury and Criminal cases.

Moz DA: 34 Moz Rank: 4.2 Semrush Rank: 706,608
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

hersemlaw.com
Hersem Law | Tampa Criminal Defense Lawyer
Picking the right criminal defense attorney in Tampa will impact the severity of your sentence! Don't let a mistake ruin your life. Call 813-544-4162!

Moz DA: 24 Moz Rank: 3.3 Semrush Rank: 877,358
Categories: Business, Business

Similar?
Yes 0 No 0

baezlawfirm.com
Orlando Criminal Lawyer
The Orlando criminal lawyers at Baez Law Firm offer clients top legal representation in Florida criminal defense & civil litigation.

Facebook ♡: 661
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

feller-law.com
Criminal, Personal, Family Law Attorney | Lake Mary, Sanford, FL | Feller Law, P.A.
Feller Law, P.A. is a criminal law firm covering the metro Orlando area. Our areas of expertise includes DUI, criminal, family, personal injury law & more.

Semrush Rank: 3,049,453
Categories: Business, Business

Similar?
Yes 0 No 0

floridasexcrimeattorney.com
Florida Sex Crime Defense Lawyers | FL Sexual Assault Attorneys | Whittel & Melton
Free Consultation - Call (866) 608-5529 - Whittel & Melton aggressively represents the accused against charges in Sex Crime & Sexual Assault cases.

Semrush Rank: 2,567,823
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

inlawwetrust.com
Divorce Lawyers For Men Tampa - Divorce For Men Tampa FL | In Law We Trust, P.A.
Experienced divorce lawyers for men in Tampa FL offering a variety of legal services. Call (813) 415-3510 today for a free consultation with a divorce for men specialist.

Semrush Rank: 4,275,941
Categories: Business, Business

Similar?
Yes 0 No 0

mosesandrooth.com
Orlando Criminal Defense Lawyers Moses & Rooth
The criminal defense lawyers at Moses & Rooth are proud to serve Orlando. We handle a variety of criminal matters. Let us work for you!

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

theadvocateforyou.com
Tampa Criminal Defense Attorney | Experienced Defense Lawyers
If you are facing criminal charges in Tampa contact our skilled criminal defense attorneys for help. We have the experience you need, call today.

Categories: Blogs/Wiki, Government and Legal Organizations

Similar?
Yes 0 No 0

tampaflcriminaldefenselawyers.com
Criminal Defense Lawyer | St. Petersburg | The Law Office of Timothy Hessinger
The St. Petersburg criminal defense attorney at The Law Office of Timothy Hessinger is former prosecutor with 15+ years' experience. Free consultation!

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

ansaralaw.com
Fort Lauderdale Criminal Defense Lawyer | Broward County Criminal Defense Attorney | Richard Ansara
Free Consultation - Call (877) 277-3780 - Richard Ansara aggressively represents the accused against charges in Criminal & Criminal Defense cases.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

eiglarshlaw.com
Fort Lauderdale Criminal Defense Lawyer | Hollywood Crime Attorney | Mark Eiglarsh
Call 305.674.0003 - Miami Criminal Defense Lawyer Mark Eiglarsh at Eiglarsh Law serve the Greater Miami South Florida Area and can help you with your Criminal and Federal Defense Cases.

Facebook ♡: 1
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

paulpetruzzi.com
Federal Criminal Defense; Attorney | Florida
Law Offices of Paul D. Petruzzi offers seasoned criminal defense representation to Miami and the surrounding area.

Semrush Rank: 3,273,941
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

greytesh.com
Grey Tesh - Law is not black or white, it's grey
Grey Tesh - Law is not black or white, it's grey

Semrush Rank: 1,209,552
Categories: Marketing/Merchandising, Political Organizations

Similar?
Yes 0 No 0

fd.org
Home | fd.org: DSO Training Division
Welcome to the home page of fd.org, a web site designed to provide resources for defense attorneys appointed as counsel under the Criminal Justice Act. This site is administered by the Defender Services Office Training Division. Lobbying group in the United States. The American Farm Bureau Federation (AFBF), more informally called the American Farm Bureau (AFB) or simply the Farm Bureau, is a United States-based trade association, lobbying group, and insurance network. Headquartered in Washington, D.C., the Farm Bureau has affiliates in all 50 states and Puerto Rico. Each affiliate is a (state or county) Farm Bureau, and the parent organization is also often called simply the Farm Bureau. Founded in 1911, the Farm Bureau movement birthed a national lobbying organization in 1920. For decades, it has been among the agriculture industry's largest lobby groups; in 2021, the AFBF spent $2,530,000 on lobbying.

Moz DA: 54 Moz Rank: 4.7 Semrush Rank: 57,011 Facebook ♡: 11
Categories: Government/Military, Government and Legal Organizations

Similar?
Yes 0 No 0

attorneyforman.com
Florida Appeals Lawyer | Post-Conviction Lawyer | Statewide
Call an experienced and respected appeals lawyer who exclusively focuses on criminal appeals and post-conviction matters in Florida.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

therickmanlawfirm.com
Criminal Defense Attorney Tampa, Best Federal Defense Attorney St. Petersburg, Federal Criminal Defense Lawyer Tampa
The Rickman Law Firm is a Florida Law Firm dedicated to providing superior legal representation in the areas of Criminal Defense, DUI Defense and Personal Injury. If you are in need of legal representation contact Anthony Rickman today for a free consultation.

Semrush Rank: 693,774
Categories: Business, Business

Similar?
Yes 0 No 0

pagepate.com
The Church Law Firm - Top Trial Lawyers
The attorneys of The Church Law Firm are among the best trial lawyers in the US. Based in Atlanta and handling federal cases nationwide.

Moz DA: 39 Moz Rank: 4 Semrush Rank: 261,906
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

joffefederaldefense.com
Federal Defense Attorney in Fort Lauderdale, Florida | (954) 723-0007
If you've been charged with a federal crime in Fort Lauderdale, you need an experienced federal defense lawyer by your side. Available 24x7.

Semrush Rank: 2,892,141
Categories: Business, Business

Similar?
Yes 0 No 0

south-floridaattorney.com
South Florida Personal Injury Attorneys | Falk & Ross Law Firm
Recovered Millions in Verdicts and Settlements – Over 40 Years of Experience in Florida Criminal Case Or Personal Injury We Can Help! Have you recently been in a car accident? Have you slipped and fell and sustained an injury? Are you trying to represent yourself in court? Have you been charged with a misdemeanor/felony? Have you been charged with possession ... Read More

Semrush Rank: 2,813,217
Categories: Business, ???

Similar?
Yes 0 No 0

pslaw.org
pslaw.org
One moment, please...

Categories: Blogs/Wiki, Business

Similar?
Yes 0 No 0

dennislopezlaw.com
DUI & Traffic Ticket Attorneys in Tampa | Florida Criminal Defense Law Firm | Dennis A. Lopez, Attorney at Law
If you've received a DUI charge or traffic ticket in Tampa, contact Dennis A. Lopez, Attorney at Law for skilled representation.

Semrush Rank: 1,949,572
Categories: Business, Business

Similar?
Yes 0 No 0

jayleiderman.com
Ventura Criminal Defense Lawyer | CA Defense Attorney | Jay Leiderman
Attorney Jay Leiderman defends those charged with criminal offenses throughout Southern California. Lawyer serving Ventura, Oxnard and surrounding areas.

Categories: Business, Business

Similar?
Yes 0 No 0

attorneyhamilton.com
Exposing The Truth | Texas Criminal Defense Group
Looking for a Texas lawyer committed to fighting for your future? Call the Texas Criminal Defense Group! Exposing the Truth

Semrush Rank: 277,089 Facebook ♡: 2,049
Categories: Sports, Business

Similar?
Yes 0 No 0

tampacriminaldefenselawyer.com
Tampa Criminal Defense Lawyer, Board-Certified for 20 Years - Lori D. Palmieri, P.A.
Criminal Justice Lawyer Since 1990, Proudly Defending Tampa Since 2003. Lori D. Palmieri, is a Board Certified Criminal Defense Lawyer practicing in the gre

Categories: Government/Military, Government and Legal Organizations

Similar?
Yes 0 No 0

matassinilaw.com
Tampa Car Accident Lawyer
The Tampa car accident lawyers at Matassini Law Firm, P.A. help clients who have been injured in car, truck & motorcycle accidents, call for a free consultation.

Semrush Rank: 2,304,416
Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

criminaldefenselawyertampa.com
Criminal Defense Lawyers of Tampa
Daniel J. Fernandez and Martin J. Hernandez

Semrush Rank: 2,951,296
Categories: Business, Domain Parking

Similar?
Yes 0 No 0

criminal-defense-dui.lawyer
When Bad Things Happen to Good People, Our Fort Lauderdale Criminal Defense Attorney Can Help
Fort Lauderdale criminal defense attorneys offer aggressive & accessible representation to people charged with DUI & crime in South Florida. Free consultations.

Semrush Rank: 301,472
Categories: Business, Business

Similar?
Yes 0 No 0

hillsboroughdefense.com
Tampa Criminal Defense Attorney | Metcalf Falls, Criminal Defense Attorneys, P.A.
Charged with a crime in Tampa? Get Answers and Protect Yourself. Call Criminal Defense Attorney Brett Metcalf. Free Consults Avail: (813) 258-4800.

Facebook ♡: 52
Categories: Business, Business

Similar?
Yes 0 No 0

delagranaboardman.com
Tampa Criminal Defense Lawyers - de la Grana | Boardman
The criminal law attorneys at de la Grana Boardman, are successful, experienced, knowledgeable, and reputable Tampa criminal defense lawyers.

Semrush Rank: 2,644,534
Categories: Marketing/Merchandising, Personal Websites and Blogs

Similar?
Yes 0 No 0

centrallaw.com
Speak to a Criminal Defense Attorney Near Tampa, Florida 813-222-2220 Video
Board Certified Trial Attorney answers questions, videos, 24/7/365

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

laharassmentfirm.com
Los Angeles Workplace Harassment, Discrimination, & Wrongful Termination Lawyers | The Ruttenberg Law Firm, PC
The attorneys at Ruttenberg Law Firm, PC represent Los Angeles clients in cases involving employment law, workplace sexual harassment and wrongful termination. Free Consultation.

Semrush Rank: 1,863,400
Categories: Business, Business

Similar?
Yes 0 No 0

Suggest Site to this list (markjobrien.com)

Please only suggest if the website is similar. We do check suggested websites carefully and only approve if it's completely similar.

Site Url

Why do you think it is similar?

Email address We'll never share your email with anyone else. You'll get a confirmation email.

3 (times) seven

I'm sure it's similar Yes

markjobrien.com Reviews

No reviews have been made yet.

What is sitelike.org?

sitelike.org is a free tool to search and find Similar Websites, alternatives or related to the given site.
It helps you to find similar sites based on keyword overlap and shared audience.
Our team is manually checking and finding similar websites and also our visitors are helping us to find the best similar websites.
"Similar sites like" first finds the best and top keywords for all websites and rank them.
We also use our internal algorithm with analysing the website contents and also several web sources to determine the main topics of websites which are used to find similar websites that have the closest matching set of topics. Our ranking system uses user generated content created by our team, our visitors and also our algorithm.