Similar sites like williambarabino.com

Criminal Defense Attorney in Medford MA | William J. Barabino

If you are facing serious criminal charges, attorney Barabino can help. Call (781) 393-5900 for a free consultation.

Categories: Business, Government and Legal Organizations
Topics: criminal defense attorney in medford ma, william j. barabino

Semrush Rank: 2,211,156

williambarabino.com Reviews

Sites similar to williambarabino.com - Top 72 williambarabino.com alternatives

cappettalaw.com
Framingham Criminal Lawyer | Natick Criminal Defense Attorney | Cappetta Law Offices
Free Consultation - Call (508) 762-4540 - The Cappetta Law Offices aggressively represents the accused against charges in Criminal & Criminal Defense cases.

Semrush Rank: 1,490,605
Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

mpmdefense.com
Michael Patrick Murray Criminal Defense Attorney - Worcester | Boston
Mike Murray is an experienced, zealous and understanding criminal defense attorney with a 90% success rate. Criminal Attorney Mike Murray has won over 90% of his trials. As a defense attorney Mike has won thousands of outright dismissals of his clients charges without ever having to go to trial. Call: (508) 393-4162. Email: [email protected]

Semrush Rank: 12,056,489 Facebook ♡: 1
Categories: Business, Business

Similar?
Yes 0 No 0

ryansullivanlaw.com
Lowell Criminal Defense Lawyer | Middles*x County, Massachusetts Crime Attorney | Ryan P. Sullivan
Free Consultation - Call (978) 221-6012 - Ryan P. Sullivan aggressively represents the accused against charges in Criminal Defense & Crime cases.

Semrush Rank: 2,687,472
Categories: Business, Business

Similar?
Yes 0 No 0

jbsimonslaw.com
Criminal Defense Attorney Boston MA | Attorney Joseph B Simons
Criminal Defense Attorney Boston MA, Attorney Joseph B Simons and his team offer sophisticated and personalized strategies to fight the most serious and complex charges.

Semrush Rank: 1,556,789
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

bentleylawgroupllc.com
Attorney at Law - Framingham, MA - Bentley Law Group LLC
Contact us today in Framingham, Massachusetts to speak with an attorney about how they can help with your case.

Semrush Rank: 9,104,945
Categories: Business, Business

Similar?
Yes 0 No 0

frankdoran.com
Framingham Criminal Defense Attorney | Natick DUI Lawyer | Marlborough MA Drug Crimes
Charged with a crime? Contact Framingham, Massachusetts criminal defense lawyer Frank Doran from Doran & Doran, P.C., at 508-653-1761. First consultation free.

Semrush Rank: 6,235,568
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

zirlenlaw.com
Framingham Criminal Defense Attorney | Middles*x County Personal Injury Lawyer
Whether you need representation in criminal court or before an insurance adjuster, you can count the law offices of David B. Zirlen. Call 508-319-1641 today.

Semrush Rank: 18,651,161
Categories: Business, Business

Similar?
Yes 0 No 0

bostonmassduiattorney.com
Massachusetts DUI & Criminal Defense Lawyer | DeGiacomo & Mikhlin, P.C.
Boston DUI Attorneys James G. DeGiacomo and Sergey Mikhlin specialize in MA DUI defense and license suspension appeals. Contact DUI attorneys James G. DeGiacomo and Sergey Mikhlin in Boston, MA.

Semrush Rank: 1,849,369 Facebook ♡: 201
Categories: Business, Business

Similar?
Yes 0 No 0

bostoncriminallawyer.com
Boston Criminal Lawyer | Suffolk County DUI Attorney | Lefteris K. Travayiakis
Free Consultation - Call (617) 325-9500 - Lefteris K. Travayiakis aggressively represents the accused against charges in Criminal & Criminal Defense cases.

Facebook ♡: 2
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

thenieveslawfirm.com
Oakland Criminal Lawyer | California Criminal Defense | Nieves Law Firm
To protect your rights and build a strong defense following a criminal charge, consult with an Oakland criminal lawyer with the Nieves Law Firm today. Our defense attorneys have years of experience helping defend those accused of crimes in California and are available to help guide you through the justice system.

Semrush Rank: 262,868
Categories: Business, Political Organizations

Similar?
Yes 0 No 0

roubillaw.com
Immigration & Criminal defense
With Immigration Law Offices in Cambridge & Framingham, Massachusetts, our Immigration Lawyers help file immigration applications for green cards, citizenship, & defends against deportation in immigration court.

Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

pdonovanlaw.com
Massachusetts Criminal Attorney | Ma Criminal Lawyer | Criminal Lawyer
Massachusetts Criminal Attorney Patrick Donovan 617 479-1800. Ma criminal lawyer and former Assistant District Attorney- Available 24/7

Moz DA: 22 Moz Rank: 3.7 Semrush Rank: 659,972 Facebook ♡: 0
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

leonelawoffices.com
Divorce and Criminal Defense Lawyer in Framingham and Hyannis Cape Cod
Attorney Joseph Leone is a top rated divorce and criminal defense lawyer in Framingham, Massachusetts and Hyannis, Cape Cod. Call for your case evaluation.

Semrush Rank: 7,562,650
Categories: Business, Business

Similar?
Yes 0 No 0

rsweeneylaw.com
Quincy Criminal Defense Lawyer
Accused of a crime? Our Quincy criminal defense lawyers have 20+ years of combined legal experience. Get in contact with Sweeny & Associates, LLC 24/7 for a free case consultation!

Semrush Rank: 1,102,813
Categories: Business, Domain Parking

Similar?
Yes 0 No 0

arnellaw.com
Law Office of Philip L. Arnel | Expunging Records in Westwood
The Law Office of Philip L. Arnel has stood up for thousands of people across the Boston area. Call 781-708-4137 to schedule your free consultation today.

Categories: Education/Reference, Business

Similar?
Yes 0 No 0

rakhlinlaw.com
Boston Criminal Lawyer | Massachusetts Criminal Attorney | Rakhlin Law
Rahklin Law Offers Experienced & Diligent Boston Criminal Defense Case Representation. Call Today for a FREE Case Evaluation: 617-564-0466.

Semrush Rank: 10,690,587
Categories: Business, Business

Similar?
Yes 0 No 0

serpalaw.com
Boston Criminal Defense Lawyer | Suffolk County, Massachusetts Crime Attorney | Serpa Law Office
Free Consultation - Call (617) 936-0201 - Serpa Law Office aggressively represents the accused against charges in Criminal Defense & Crime cases.

Facebook ♡: 0
Categories: Business, Business

Similar?
Yes 0 No 0

markhelwig.com
Greater Boston Metrowest Attorney | Criminal Defense | DUI OUI DWI Lawyer | Sudbury Personal Injury Attorney | Juvenile Crimes | Framingham Lawyer
Greater Boston Metrowest criminal defense attorney, Mark W. Helwig provides skilled legal services to individuals in the Boston Metrowest area, including Sudbury clients, in drunk driving (DUI) and other criminal matters, including juvenile crimes, and motor vehicle accident cases

Semrush Rank: 7,584,156
Categories: Business, Business

Similar?
Yes 0 No 0

mikhlinlaw.com
Criminal Defense Attorney | Criminal Defense Lawyer Massachusetts
Free call (508) 271-7781 Criminal Defense Attorney | Criminal Defense Lawyer MA (DUI/OUI) successfully practicing for over 16 years.

Categories: Business, Business

Similar?
Yes 0 No 0

masscriminaldefense.com
Massachusetts Criminal Defense Lawyers - MassCriminalDefense.com
Arrested in Massachusetts? Call (781) 817-6332 immediately for a free legal defense consultation. We fight cases in all Mass courts! Protect your rights.

Categories: Portal Sites, Government and Legal Organizations

Similar?
Yes 0 No 0

zalkindlaw.com
Boston Criminal Defense Lawyer | Massachusetts Employment Attorney | Zalkind Duncan & Bernstein LLP
617-742-6020 Zalkind Duncan & Bernstein LLP - Boston, Massachusetts Criminal Defense & Employment Lawyers. Serving Clients Nationwide.

Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

foglialaw.com
foglialaw.com
One moment, please...

Semrush Rank: 18,490,190
Categories: Business, Business

Similar?
Yes 0 No 0

dellisonlaw.com
David Ellison Law
David Ellison Law

Categories: Business, Business

Similar?
Yes 0 No 0

massachusetts-drug-crimes-lawyers.com
Boston Drug Crime Lawyer | Suffolk County, Massachusetts Drug Possession Attorney | Stephen Neyman
Free Consultation - Call (617) 263-6800 - Stephen Neyman aggressively represents the accused against charges in Drug Crime and Drug Possession cases.

Moz DA: 16 Moz Rank: 2.3 Semrush Rank: 3,157,075 Facebook ♡: 0
Categories: Business, Not Rated

Similar?
Yes 0 No 0

obrienlawboston.com
O'Brien Law Boston, PC | Boston and Hingham | Best Criminal Defense Attorney Boston Frank O'Brien
We are an experienced team of Boston Criminal Defense lawyers, with a distinguished record of providing superior legal advocacy, and a reputation for working tirelessly towards accomplishing the individualized goals of every single client for Drug, DUI, OUI, defense.

Semrush Rank: 5,167,769
Categories: Business, Information Technology

Similar?
Yes 0 No 0

davidyannetti.com
Boston Criminal Defense Lawyers | Top Criminal Attorneys
Free Case Evaluation - Our Top-Rated Boston Criminal Defense Lawyers Will Provide You With the Best Representation in MA. Offices in Boston, Salem, & Dedham.

Facebook ♡: 1
Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

worcesterlawgroup.com
Worcester Law Group - Criminal Defense And Landlord Attorney In MA
Attorney John Elloian is a Worcester MA based attorney who focuses on criminal defense and landlord representation. For free consultation call 508-752-2400.

Semrush Rank: 5,149,755
Categories: Business, Business

Similar?
Yes 0 No 0

leeperassociates.com
Leeper & Associates - Framingham, Massachusetts Law Firm
Leeper & Associates is an immigration and criminal defense law firm in Framingham, MA, offering a full spectrum of immigration legal services for individuals, families, employers and employees. Specializing in US immigration law, green cards, naturalization, visas and deportation, and representing clients within the United States and Immigration Services (USCIS) and Customs Enforcement (ICE) in both criminal and non-criminal matters.

Semrush Rank: 5,516,759
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

mpklawoffices.com
Cape Cod Criminal Defense Lawyer | Barnstable County, Massachusetts DUI Defense Attorney | Matthew P. Kelley
Free Consultation - Call (508) 432-3304 - Matthew P. Kelley aggressively represents the accused against charges in Criminal Defense & DUI Defense cases.

Semrush Rank: 4,511,801
Categories: Business, Business

Similar?
Yes 0 No 0

neymanlaw.com
Boston Criminal Defense Lawyer | Massachusetts Criminal Attorney | Law Offices of Stephen Neyman
Free Consultation - Call 617-263-6800 - Available 24/7. Law Offices of Stephen Neyman - Boston, Massachusetts criminal defense lawyer. Experienced attorney defending criminal cases throughout Massachusetts, state and federal courts.

Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

disabilitylaw.ca
Disability Lawyer Calgary - Free Consultation - Bayda Law Firm
Experienced Calgary Disability Lawyer 1-403-670-0070. No fees until recovery. Let them help you appeal your long term disability insurance claim denial.

Categories: Business, Reference

Similar?
Yes 0 No 0

masslawyer.info
Boston Criminal Defense Lawyer | Massachusetts Criminal Attorney | Law Offices of Stephen Neyman
Free Consultation - Call 617-263-6800 - Available 24/7. Law Offices of Stephen Neyman - Boston, Massachusetts criminal defense lawyer. Experienced attorney defending criminal cases throughout Massachusetts, state and federal courts.

Categories: Business, Business

Similar?
Yes 0 No 0

gagarinlaw.com

- MA Immigration and Criminal Defense
- MA Immigration and Criminal Defense

Semrush Rank: 47,143,399
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

delsignoredefense.com
Massachusetts OUI Lawyer | MA DUI Attorney | DelSignore Law
Attorney Michael DelSignore helps people avoid and OUI conviction and get their license back. If you are charged with OUI or a criminal charge in Massachusetts, we can help.

Semrush Rank: 614,523
Categories: Sports, Government and Legal Organizations

Similar?
Yes 0 No 0

glennafrenchlaw.com
Glenn A French Attorney at law - Expert Framingham, MA
FREE initial consultation. Family Law, Personal Injury, Criminal Defense, Estate Planning, Real Estate, Work Compensation. Call 508-879-7770.

Semrush Rank: 45,924,314
Categories: Business, Business

Similar?
Yes 0 No 0

massduidefenselawyer.com
Massachusetts DUI Lawyer | Boston OUI Attorney | Benjamin P. Urbelis, Esq.
Free Consultation - 617-830-2188 Benjamin P. Urbelis, Esq. - If you have been charged with DUI, OUI, or any other DUI crime speak to an experienced attorney for legal representation in criminal matters in Massachusetts

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

topaziolaw.com
Criminal Defense and Personal Injury Attorney Boston MA
Attorney Steven J. Topazio has experience in Criminal Defense Law, Misdemeanor, Felony, Domestic Violence, Drugs, DUI, Drunk Driving, Weapon Charges, Personal Injury Law, Car/Auto Accidents, Brain Injury, Premises Liability and Dog Bites Law cases in Boston MA. Call us at (617) 422-5803 for a free consultation.

Categories: Marketing/Merchandising,

Similar?
Yes 0 No 0

sbmannlaw.com
Lawyer Serving Needham, MA
Call Mann Law Firm P.C. in Needham, MA at 617-690-7379 now for Lawyer services you can rely on!

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

kevlaw2.com
Criminal Defense Attorney,Bankruptcy Law: Medway, Milford & Framingham, MA
Kevin Tagliaferri, Attorney at Law in Medway, MA is an experienced criminal defense attorney focusing on juvenile cases. Chapter 7 & 13 bankruptcy law too.

Semrush Rank: 50,227,079
Categories: Business, Business

Similar?
Yes 0 No 0

oberhauserlaw.com
OUI Attorney | Criminal Defense | Oberhauser Law Lowell, MA
The OUI attorney in Lowell fighting for you, Oberhauser Law specializes in Massachusetts criminal defense. Contact us now (978) 452-1116.

Semrush Rank: 467,274 Facebook ♡: 627
Categories: Business, Business

Similar?
Yes 0 No 0

attorneychan.com
The Law Offices of Jason Chan
The Law Offices of Jason Chan

Semrush Rank: 3,237,308
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

bostoncriminaldefenselawyers.com
Boston Criminal Lawyer | Suffolk County Criminal Defense Attorney | Patrick J. Murphy
Free Consultation - Call (617) 367-0450 - Patrick J. Murphy aggressively represents the accused against charges in Criminal & Criminal Defense cases.

Categories: Business, Political Organizations

Similar?
Yes 0 No 0

elliotsavitz.com
The Law Offices Of Elliot Savitz & Scott Bradley
Facing a criminal charge can be an extremely frightening time. Contact The Law Offices of Elliot Savitz & Scott Bradley & receive a free consultation.

Semrush Rank: 4,257,793
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

tampaflcriminaldefenselawyers.com
Criminal Defense Lawyer | St. Petersburg | The Law Office of Timothy Hessinger
The St. Petersburg criminal defense attorney at The Law Office of Timothy Hessinger is former prosecutor with 15+ years' experience. Free consultation!

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

mortelaw.com
Top Rated Lawyers in Marlborough MA
Briones & Morte are experienced and top rated lawyers in Marlborough, Massachusetts. They concentrate in divorce and family law, criminal defense, and personal injury cases.

Semrush Rank: 9,265,546
Categories: Business, Reference

Similar?
Yes 0 No 0

middlesexda.com
Middles*x County District Attorney's Office |
Middles*x County District Attorney's Office |

Moz DA: 52 Moz Rank: 4.3 Semrush Rank: 272,055
Categories: Government/Military, Government and Legal Organizations

Similar?
Yes 0 No 0

paulnyeresq.com
Framingham Personal Injury Lawyer | Divorce | Property Division
Attorney Paul Nyer in Framingham, Massachusetts, solves personal injury, family law and criminal defense problems. Free consultation, call 508-283-4250.

Semrush Rank: 16,891,236
Categories: Business, Business

Similar?
Yes 0 No 0

andrewcowanlaw.com
Boston Attorney | Criminal Defense, Family Law, Estate Planning
Experienced lawyers for all your legal needs in Boston, Massachusetts. At PiltserCowan Law LLC, we treat you like family. Call 617-804-7228 for a free initial consultation.

Semrush Rank: 47,949,946
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

johnseedlaw.com
Lawyer in New Bedford, MA | Attorney John B. Seed
Are you in need of a lawyer for a matter related to violent crimes, DUIs, domestic violence, etc.? Contact Attorney John B. Seed in New Bedford, MA.

Semrush Rank: 1,836,084
Categories: Business, Political Organizations

Similar?
Yes 0 No 0

ekglawyers.com
Westwood Criminal Defense Attorneys
The Westwood criminal defense lawyers at Eisenstadt & Krippendorf Group, LLP bring 50 years’ combined experience to your case. Free consultation.

Semrush Rank: 793,581 Facebook ♡: 1
Categories: Business, Business

Similar?
Yes 0 No 0

dharlawllp.com
Top Boston Criminal Defense Lawyer | White Collar & Federal Crimes | Dhar Law LLP
WHY CHOOSE DHAR LAW, LLP? We Are Experienced Attorneys Working Together As A Team Our Boston attorneys began their legal careers working for international law firms, government agencies, business and industry, and non-profits before deciding to join Dhar Law, LLP. Our practice philosophy assures a level of service that creates real value for our clients…

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

brudviklaw.com
Divorce Attorney | Family Law | Criminal Defense | West Fargo, ND
Brudvik Law Office handles a wide range of legal matters for clients throughout North Dakota and western Minnesota. Call 701-786-6177 for a consultation.

Semrush Rank: 1,959,433
Categories: Business, Information Technology

Similar?
Yes 0 No 0

hbmhlaw.com
Boston-Framingham Personal Injury Lawyers | Cambridge Accident Attorney | Heinlein Beeler Mingace & Heineman, P.C.
Free Consultation - Heinlein Beeler Mingace & Heineman, P.C. If you or someone you know has been injured in a personal injury accident, contact us at (508) 626-8500 to arrange a free consultation.

Semrush Rank: 3,104,030
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

joffefederaldefense.com
Federal Defense Attorney in Fort Lauderdale, Florida | (954) 723-0007
If you've been charged with a federal crime in Fort Lauderdale, you need an experienced federal defense lawyer by your side. Available 24x7.

Semrush Rank: 2,892,141
Categories: Business, Business

Similar?
Yes 0 No 0

kodesq.com

Categories: Business, Business

Similar?
Yes 0 No 0

urbelislaw.com
Boston Criminal Lawyer | Suffolk County Criminal Defense Attorney | Urbelis Law, LLC
Free Consultation - Call (617) 830- 2188 Urbelis Law, LLC - If you have been charged with OUI, DUI, drug offense, domestic violence or any other crime speak to an experienced attorney for legal representation in criminal matters in Boston, MA

Categories: Business, Political Organizations

Similar?
Yes 0 No 0

wisemantriallaw.com
Orlando Criminal Defense Lawyer | The Wiseman Law Firm
Arrested or charged with a crime? Put our skilled Orlando criminal defense lawyer on your side. We offer 15+ years of trial-tested experience.

Semrush Rank: 703,622 Facebook ♡: 1
Categories: Business, Information Technology

Similar?
Yes 0 No 0

terridaniellaw.com
McKinney Criminal Defense Attorney | Drug Charges, Juvenile Law
Aggressive Criminal Defense In Collin County, Texas Contact Us First-Rate Criminal Defense In Collin County Being investigated, accused, or charged with a crime

Semrush Rank: 11,566,237
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

renolawoffices.com
Worcester Workers Compensation Law Firm | Fitchburg Criminal Defense Attorney
A Worcester lawyer from the Law Office of Michael J. Reno, P.C., can help you resolve your legal issue. Call 508-471-3046 for a free consultation.

Semrush Rank: 54,403,911
Categories: Business, Business

Similar?
Yes 0 No 0

parkerslaw.com
E Peter Parker
E Peter Parker

Categories: Business, Shopping

Similar?
Yes 0 No 0

russelldefensefirm.com
Award Winning Criminal Defense Lawyer | Adam Russell |
Award Winning Criminal Defense Lawyer | Adam Russell |

Semrush Rank: 6,692,414
Categories: Business, Political Organizations

Similar?
Yes 0 No 0

attyrobertlewin.com
Massachusetts Criminal Defense Attorney | North Andover Criminal Lawyer | Lewin & Lewin
Free Consultation - Call (978) 258-3520 - Lewin & Lewin aggressively represents the accused against charges in Criminal Defense & Criminal cases.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

duilawyer-massachusetts.com
GoDaddy Security - Access Denied
GoDaddy Security - Access Denied

Semrush Rank: 837,618
Categories: Sports, Armed Forces

Similar?
Yes 0 No 0

dcdclaw.com
Greater Boston Metrowest MA Attorneys | Business Law | Employment Law | Estate Planning | Real Estate | Litigation | Divorce Lawyers
We are Massachusetts attorneys concentrating in businesses law, criminal defense, divorce and family law, employment law, estate planning, personal injury, real estate, and litigation matters.

Moz DA: 28 Moz Rank: 2.7 Semrush Rank: 27,529,477
Categories: Blogs/Wiki, Government and Legal Organizations

Similar?
Yes 0 No 0

massachusettscriminaldefenseattorneyblog.com
Massachusetts Criminal Defense Attorney Blog
Massachusetts Criminal Defense Attorney Blog — Published by Boston, Massachusetts Criminal Defense Lawyer — Stephen Neyman, P.C.

Categories: Blogs/Wiki, Government and Legal Organizations

Similar?
Yes 0 No 0

geoffreygnathanlaw.com
Top Boston Massachusetts Criminal & Federal Defense Lawyer || Geoffrey G Nathan Law Offices
Attorney Geoffrey Nathan is a top criminal defense attorney in Massachusetts. He is a nationally ranked criminal defense lawyer and has 20+ years of experience.

Semrush Rank: 1,471,760 Facebook ♡: 136
Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

relentlessdefense.com
Mahoney Criminal Defense Group - Mahoney
Mahoney Criminal Defense Group - Mahoney

Moz DA: 33 Moz Rank: 3.3 Semrush Rank: 715,544 Facebook ♡: 1
Categories: Education/Reference, Business

Similar?
Yes 0 No 0

kjclawfirm.com
Boston Personal Injury Lawyers - Boston Accident Lawyers - Massachusetts Business Litigation Attorneys
Boston Accident Lawyers, KJC Law Firm, are personal injury attorneys who specialize in accident and injury cases

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

bostondefenselaw.com
Boston Criminal Defense Attorney - C. Henry Fasoldt
If you or a loved one has been charged with a crime in Massachusetts, you know exactly how much is at stake. Call (617) 338-0009.

Semrush Rank: 714,188
Categories: Business, Business

Similar?
Yes 0 No 0

massinc.org
Home - MassINC
We are the Massachusetts Institute for a New Commonwealth Founded in 1996, MassINC’s mission is to provide the people of Massachusetts with the information they need to participate fully in our democracy. We are a nonpartisan 501c3 and achieve impact through independent research, nonprofit journalism and civic engagement. Non-partisanPolicy center The nonprofit Massinc Policy Center produces(...)

Facebook ♡: 15
Categories: Non-Profit/Advocacy/NGO, General Organizations

Similar?
Yes 0 No 0

kgdefenselaw.com
Keren Goldenberg: Criminal Defense Lawyers in Lowell, MA & Belmont, MA
Searching for representation on a criminal matter? Contact Keren Goldenberg: a top 10 criminal defense lawyer with offices in Belmont and Lowell, MA.

Semrush Rank: 1,512,116
Categories: Business, Personal Websites and Blogs

Similar?
Yes 0 No 0

bostoncriminalattorneyblog.com
Boston Criminal Attorney Blog — Published by Boston, Massachusetts Criminal Defense Lawyer — William D. Kickham, Attorney At Law
Boston Criminal Attorney Blog — Published by Boston, Massachusetts Criminal Defense Lawyer — William D. Kickham, Attorney At Law

Categories: Blogs/Wiki, Government and Legal Organizations

Similar?
Yes 0 No 0

Suggest Site to this list (williambarabino.com)

Please only suggest if the website is similar. We do check suggested websites carefully and only approve if it's completely similar.

Site Url

Why do you think it is similar?

Email address We'll never share your email with anyone else. You'll get a confirmation email.

3 (times) seven

I'm sure it's similar Yes

williambarabino.com Reviews

No reviews have been made yet.

What is sitelike.org?

sitelike.org is a free tool to search and find Similar Websites, alternatives or related to the given site.
It helps you to find similar sites based on keyword overlap and shared audience.
Our team is manually checking and finding similar websites and also our visitors are helping us to find the best similar websites.
"Similar sites like" first finds the best and top keywords for all websites and rank them.
We also use our internal algorithm with analysing the website contents and also several web sources to determine the main topics of websites which are used to find similar websites that have the closest matching set of topics. Our ranking system uses user generated content created by our team, our visitors and also our algorithm.