Similar sites like bluemoonrising.org

Blue Moon Rising on Deep Creek Lake Cabin Rentals

Blue Moon Rising on Deep Creek Lake, Maryland cabin rentals. Ecotourism and sustainability. Find out what makes us so unique.

Categories: Travel, Business

Semrush Rank: 383,461

bluemoonrising.org Reviews

Sites similar to bluemoonrising.org - Top 73 bluemoonrising.org alternatives

dclhotel.com
Home - The Lodges at Sunset Village
Six different luxury hotel-style suite floor plans located in the heart of Deep Creek Lake. The Lodges offer a comfortable and economical option for your mountain vacation or for your business retreat accommodations. Each suite offers lake access, DCL largest dock, free Wi-Fi, flat screen TV, choose full kitchen or kitchenette, and all cabins have a gas fireplace! A meeting room, picnic area, laundry facilities, kids swing set, fire pits and barbecue grills are provided in the common areas.

Categories: Travel, Travel

Similar?
Yes 0 No 0

deepcreeklodging.com
Deep Creek Lake Vacation Rentals | Railey Vacations | Deep Creek Lake
Your Deep Creek Lake Vacation Planning Guide and resource for all Vacation Rental Home Information at Deep Creek Lake, Maryland.

Semrush Rank: 1,737,864
Categories: Travel, Travel

Similar?
Yes 0 No 0

deepcreek.com
Deep Creek Lake Vacation Rentals | Railey Vacations | Deep Creek Lake
Your Deep Creek Lake Vacation Planning Guide and resource for all Vacation Rental Home Information at Deep Creek Lake, Maryland.

Categories: Public Information, Travel

Similar?
Yes 0 No 0

hobbitatspaces.com
Hobbitat
Hobbitat

Semrush Rank: 911,065
Categories: Travel, Business

Similar?
Yes 0 No 0

savageriverlodge.com
Savage River Lodge | Luxury cabins and yurts in Western Maryland
Effortlessly elegant cabins, yurts, and gourmet dining nestled within
Savage River State Forest in western Maryland.

Moz DA: 37 Moz Rank: 3.6 Semrush Rank: 250,288
Categories: Travel, Shopping

Similar?
Yes 0 No 0

deepcreekvacations.com
Deep Creek Lake Vacation Rentals & Real Estate Sales | Taylor-Made Vacations & Sales
Find the best Deep Creek Lake Rentals with Taylor-Made Deep Creek Vacations & Sales. Search our huge selection of Deep Creek vacation rentals and homes for sale in McHenry, MD.

Categories: Recreation/Travel, Business/Real Estate, Business, Travel, Travel

Similar?
Yes 0 No 0

visitdeepcreek.com
Home - Garrett County Chamber of Commerce, MD
The Garrett County Chamber of Commerce provides support for small businesses and the tourism industry, making this membership organization a unique engine for economic growth in Maryland.

Facebook ♡: 97
Categories: Travel, Business

Similar?
Yes 0 No 0

deepcreeklake.com
Deep Creek Lake, Maryland Vacation & Local Information - Railey Vacations
Visit the Deep Creek Lake's largest Visitor's Guide. Deep Creek Lake is located in the beautiful mountains of western Maryland. At Deep Creek Lake enjoy a wide variety of outdoor recreational activities for all seasons. See us for the area's most comprehensive directory for this amazing vacation destination!

Moz DA: 33 Moz Rank: 4 Semrush Rank: 33,671 Facebook ♡: 30
Categories: Public Information, Reference

Similar?
Yes 0 No 0

offlakerentals.com
Offlake Rentals | Deep Creek Lake Vacation Rentals
Offlake Rentals in Deep Creek Lake offering vacation rentals for your Glamping and Lodging experience. We're near Maryland's WISP Ski Resort, highest waterfall and other attractions. We're the affordable vacation choice. Vacation Rentals in Oakland, McHenry, Swanton and Friendsville.

Categories: Recreation/Hobbies, Travel

Similar?
Yes 0 No 0

deepcreeklakeproperty.com
Deep Creek Lake Homes For Sale | Real Estate Sales | Betsy Spiker Holcomb
Welcome to Deep Creek Lake, MD and Taylor-Made Deep Creek Vacations -- check out our amazing selection of vacation rentals and homes for sale.

Categories: Real Estate, Real Estate

Similar?
Yes 0 No 0

suitesatsilvertree.com
Deep Creek Lake Hotel | Suites at Silver Tree
The Suites at Silver Tree are Deep Creek Lake's only lakefront hotel and luxury suites. Relax in style and comfort on your next trip to Deep Creek Maryland.

Facebook ♡: 17
Categories: Travel, Business

Similar?
Yes 0 No 0

willothewisp.com
Deep Creek Condo Rentals | Will O' The Wisp
Will O' the Wisp offers 47 luxurious condo rentals in Deep Creek, Maryland with beautiful lake views. Fully unwind at this year-round lakeside sanctuary.

Moz DA: 27 Moz Rank: 3.4 Semrush Rank: 490,168
Categories: Travel, Travel

Similar?
Yes 0 No 0

railey.com
Deep Creek Lake Real Estate | Homes For Sale | Waterfront Homes
Deep Creek Lake and Garrett County, Maryland's leading real estate brokerage - Railey Realty. The area's most trusted name for over 40 years. Our website offers the largest selection of available vacation and second homes for sale, lots and land, condominiums, townhomes, and investment properties.

Facebook ♡: 0
Categories: Auctions/Classifieds, Real Estate

Similar?
Yes 0 No 0

paradiseridgehoa.com
Paradise Ridge
Paradise Ridge

Semrush Rank: 3,009,485
Categories: Travel, Business

Similar?
Yes 0 No 0

weddingsatdeepcreek.com
Wedding Venues | Weddings at Deep Creek | 877.567.2183
Choosing wedding venues is one of the biggest decisions about your big day. Our team makes weddings at Deep Creek the perfect balance of elegant & casual.

Semrush Rank: 5,415,415
Categories: Marketing/Merchandising, Travel

Similar?
Yes 0 No 0

carmelcoveinn.com
Deep Creek Lake Hotels | Carmel Cove Inn at Deep Creek Lake
Hotel | Deep Creek Lake Lodging Accommodations Resort
Carmel Cove Inn at Deep Creek
Lake. Premier Location and Accommodations of Deep Creek Lake
Hotels. Luxury mountain lodge hotel, dock, canoes on Deep Creek
Lake

Categories: Travel, Travel

Similar?
Yes 0 No 0

shenandoahcabinrentals.com
Shenandoah Cabin Rentals
Rent comfortable waterfront cabins and cottages in the Shenandoah Valley, Virginia. Fish, canoe, kayak, BBQ, picnic and more at these luxurious vacation homes.

Categories: Travel, Travel

Similar?
Yes 0 No 0

discoverycenterdcl.com
The Discovery Center at Deep Creek Lake State Park
The Discovery Center at Deep Creek Lake State Park

Moz DA: 29 Moz Rank: 3.2 Semrush Rank: 978,803 Facebook ♡: 507
Categories: Education/Reference, Sports

Similar?
Yes 0 No 0

deepcreektimes.com
Home - Deep Creek Times
Welcome to Deep Creek Times: THE online information source for Garrett County and Deep Creek Lake, Maryland. Daily Notes blog, news, weather, business and area directory. By Sarah Myers

Categories: Public Information, Reference

Similar?
Yes 0 No 0

northgladeinn.com
North Glade Inn Deep Creek Lake Bed & Breakfast, Rural Western Maryland
Deep Creek Lake Bed and Breakfast on a farm with 10 rooms, country breakfasts, fishing pond, nine hole par 3 golf course.

Categories: Travel, Travel

Similar?
Yes 0 No 0

moonshadow145.com
MoonShadow - Food, Music, Drinks, Conversation & more. Located in Deep Creek Lake, Maryland
Fantastic food & live music venue located in beautiful Deep Creek Lake,
Maryland!

Categories: Restaurants, Arts and Culture

Similar?
Yes 0 No 0

chanteclairefarm.com
Chanteclaire Farm
Deep Creek, Maryland's most elegant wedding barn. A historic property
styled with European sensibilities, we are a full service wedding venue
offering planning, catering, cake, decor and DJ onsite.

Semrush Rank: 1,529,684 Facebook ♡: 604
Categories: Travel, Travel

Similar?
Yes 0 No 0

deepcreekinns.com
#1 BEST Hotel Deep Creek MD | Lake Pointe Inn | WATERFRONT
Lake Pointe Inn a Boutique Style Deep Creek Lake Hotel with Bed and Breakfast amenities awaits your visit. Right on Deep Creek Lake and next to Wisp Mountain.

Categories: Travel, Travel

Similar?
Yes 0 No 0

deepcreekcellars.com
Natural Wines from Deep Creek Cellars - Home
WINTER HOURS: By Reservation only, through May 2023 , 301-746-4349 • SAMPLING IN OUR TASTING ROOM: Due to the small size of our facility, we are welcoming parties of fewer than 6 (vaccinated...

Categories: Alcohol, Alcohol

Similar?
Yes 0 No 0

garretttrails.org
Garrett Trails Home Page
The most reliable source for trail information in Garrett County, MD

Categories: Marketing/Merchandising, General Organizations

Similar?
Yes 0 No 0

mbcabinsontheriver.com
Meshach Browning's Cabins on the Casselman River Western Maryland
Come enjoy the tranquility of the Casselman River at Meshach Browning's cabins on the river. We are located in Western Maryland. All the cabins offer amazing views of the river.

Categories: Travel, Travel

Similar?
Yes 0 No 0

innatdeepcreek.com
Lakeside Hotel at Deep Creek Lake- Inn at Deep Creek
Enjoy the perfect Deep Creek Lake vacation at Inn at Deep Creek. Call now 301.387.5534.

Categories: Real Estate, Travel

Similar?
Yes 0 No 0

lakestarlodge.com
Lakefront lodge
BeHotel2 | Best WordPress theme for hotels

Categories: Travel, Real Estate

Similar?
Yes 0 No 0

thedeepcreekwedding.com
Home - The Deep Creek Wedding
Home - The Deep Creek Wedding

Semrush Rank: 1,753,579
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

lakewoodresortsmd.com
Lakewood Resorts
WELCOME TO LAKEWOOD RESORTS AT DEEP CREEK LAKE Vacation Ownership Resort Lakewood Resorts is situated on the lakefront of Deep Creek Lake in McHenry Maryland, a four-season area that provides many...

Semrush Rank: 2,621,629
Categories: Marketing/Merchandising, Travel

Similar?
Yes 0 No 0

logcabininthewoods.com
Log Cabin in the Woods
Maryland Cabins - Maryland Cabins : Log Cabin Lodge Sleeps: 20 Vacation Rental home located at Cunningham Falls State Park in Catoctin Mountains.

Semrush Rank: 1,193,010
Categories: Travel, Business

Similar?
Yes 0 No 0

oleminkfarm.com
Ole Mink Farm
Ole Mink Farm Recreation Resort has been operated by the Irons Family for five decades. This beautiful resort is located in a true wilderness setting, high atop the Catoctin Mountains in Frederick County, Maryland.

Moz DA: 25 Moz Rank: 3.7 Semrush Rank: 861,910
Categories: Travel, Travel

Similar?
Yes 0 No 0

thorpewood.org
ThorpeWood
ThorpeWood, a 155-acre mountain retreat, serves as an access point to nature for non-profit groups and organizations. Wedding venue and corporate rental also available.

Categories: Non-Profit/Advocacy/NGO, Travel

Similar?
Yes 0 No 0

easternshorevacations.com
Eastern Shore Vacation Rentals | Maryland Vacation Home Rentals
Eastern Shore Vacation Rentals offers a variety of Chesapeake Bay rental homes & condos. From pet-friendly to luxury, our Maryland vacation home rentals have it all.

Moz DA: 28 Moz Rank: 3.8 Semrush Rank: 511,803 Facebook ♡: 11
Categories: Travel, Travel

Similar?
Yes 0 No 0

mountain-lodging.com
Mountain Lodging Vacation Cabin Rentals� for Romantic Weekend Getaway Escapes at Privately Owned Vacation Cabin Rental Properties
Mountain cabin rentals for romantic weekend vacation getaways at privately owned vacation cabin rentals including information on advertising your mountain vacation cabin rental property.

Moz DA: 29 Moz Rank: 4 Semrush Rank: 1,129,642
Categories: Travel, Travel

Similar?
Yes 0 No 0

wispresort.com
Wisp Resort
Wisp Resort

Moz DA: 45 Moz Rank: 4.6 Semrush Rank: 29,260 Facebook ♡: 216
Categories: Travel, Travel

Similar?
Yes 0 No 0

discoverdeepcreek.com
Deep Creek Mountain Land for Sale in Maryland
Deep Creek Mountain land for sale available now in McHenry, Maryland. For more information on beautiful land sites please contact (877) 888-7581.

Semrush Rank: 2,059,576
Categories: Real Estate, Business

Similar?
Yes 0 No 0

doublegrvpark.com
Home - Double G RV Park
Book a Camping reservation View our COVID-19 Updates Located 1/2 mile from Deep Creek Lake, MD FollowFollowFollow Services We Offer Seasonal Camping Enjoy six months of unlimited use of your camper in the fresh mountain air. Overnight Camping Full hook-up camp sites with Cable and WiFi just 1/2 mile from Deep Creek Lake. Sunflowers Sold […]

Categories: Marketing/Merchandising, Travel

Similar?
Yes 0 No 0

campdeepcreek.com
Camp Deep Creek – Camp Deep Creek
Camp Deep Creek - Camp Deep Creek

Semrush Rank: 15,901,336
Categories: Travel, Business

Similar?
Yes 0 No 0

tinyhousemd.com
Tinyhousemd · Moda in Pelle Online Outlet For Womens - Find The Best One For You.
Moda in Pelle online outlet for womens:handbags,sandals,accessories,boots and shoes.Shop online for the latest collection from Moda in Pelle. Have your favourite items delivered to your home.

Semrush Rank: 51,810,524
Categories: Blogs/Wiki, Business

Similar?
Yes 0 No 0

deepcreeklakecabinrental.com

Moz DA: 16 Moz Rank: 2 Facebook ♡: 1
Categories: Travel, Travel

Similar?
Yes 0 No 0

deepcreekrental.com
Deep creek rentals by owner in Annapolis MD.
Welcome to the Deep Creek Lake, Maryland and our three vacation rental homes. These rentals are available for rent year round for you to enjoy the many activities available at beautiful Deep Creek Lake - boating, swimming, fishing, skiing, hiking, horseback riding, or just relaxing.

Categories: Online Shopping, Travel

Similar?
Yes 0 No 0

deepcreekrealty.com
Deep Creek Lake Coldwell Banker Deep Creek Realty - Specializing in Vacation Rentals and Real Estate in Garrett County, Western Maryland
Vacation Rentals and Real Estate Sales in Deep Creek Lake and Garrett County, MD. Search for listings and explore our resort area, located in the mountains of western Maryland.

Categories: Real Estate, ???

Similar?
Yes 0 No 0

deepcreekwinery.com
JTG Photo - Professional Photography
Find the best concert photos and live music pictures covering all genres, as well as product, landscape, and artistic photographs.

Semrush Rank: 1,584,744
Categories: Business, Personal Websites and Blogs

Similar?
Yes 0 No 0

honi-honi.com
Honi-Honi Bar - Honi-Honi Bar Main
Deep Creek Lake, Maryland's Music and Drinks

Categories: Alcohol, Travel

Similar?
Yes 0 No 0

deepcreeklions.org
Deep Creek Lake Lions Club
Fundraisers, events and activities of the DCL Lions

Semrush Rank: 4,736,314
Categories: Sports, Business

Similar?
Yes 0 No 0

blackbearwineandwords.com
Our Story
Wine Shop and Bar

Facebook ♡: 0
Categories: Alcohol, Business

Similar?
Yes 0 No 0

aquatic-center.com
Aquatic Center Inc. Sea Doo Yamaha Kawasaki Deep Creek Lake BRP seadoo
Aquatic Center BRP Sea Doo Yamaha Kawasaki ATV Motorcycle Watercraft Sport Boat Utility Vehicle Jet Ski Deep Creek Lake Aquatic Center BRP Sea Doo Yamaha Kawasaki ATV Motorcycle Watercraft Sport Boat Utility Vehicle Jet Ski Deep Creek Lake Aquatic Center BRP Sea Doo Yamaha Kawasaki ATV Motorcycle Watercraft Sport Boat Utility Vehicle Jet Ski Deep Creek Lake Aquatic Center BRP Sea Doo Yamaha Kawasaki ATV Motorcycle Watercraft Sport Boat Utility Vehicle Jet Ski Deep Creek Lake Aquatic Center BRP Sea Doo Yamaha Kawasaki ATV Motorcycle Watercraft Sport Boat Utility Vehicle Jet Ski Deep Creek Lake Aquatic Center BRP Sea Doo Yamaha Kawasaki ATV Motorcycle Watercraft Sport Boat Utility Vehicle Jet Ski Deep Creek Lake Aquatic Center BRP Sea Doo Yamaha Kawasaki ATV Motorcycle Watercraft Sport Boat Utility Vehicle Jet Ski Deep Creek Lake Aquatic Center BRP Sea Doo Yamaha Kawasaki ATV Motorcycle Watercraft Sport Boat Utility Vehicle Jet Ski Deep Creek Lake Aquatic Center BRP Sea Doo Yamaha Kawasaki ATV Motorcycle Watercraft Sport Boat Utility Vehicle Jet Ski Deep Creek Lake Aquatic Center BRP Sea Doo Yamaha Kawasaki ATV Motorcycle Watercraft Sport Boat Utility Vehicle Jet Ski Deep Creek Lake Aquatic Center BRP Sea Doo Yamaha Kawasaki ATV Motorcycle Watercraft Sport Boat Utility Vehicle Jet Ski Deep Creek Lake Aquatic Center BRP Sea Doo Yamaha Kawasaki ATV Motorcycle Watercraft Sport Boat Utility Vehicle Jet Ski Deep Creek Lake Aquatic Center BRP Sea Doo Yamaha Kawasaki ATV Motorcycle Watercraft Sport Boat Utility Vehicle Jet Ski Deep Creek Lake Aquatic Center BRP Sea Doo Yamaha Kawasaki ATV Motorcycle Watercraft Sport Boat Utility Vehicle Jet Ski Deep Creek Lake Aquatic Center BRP Sea Doo Yamaha Kawasaki ATV Motorcycle Watercraft Sport Boat Utility Vehicle Jet Ski Deep Creek Lake Aquatic Center BRP Sea Doo Yamaha Kawasaki ATV Motorcycle Watercraft Sport Boat Utility Vehicle Jet Ski Deep Creek Lake Aquatic Center BRP Sea Doo Yamaha Kawasaki ATV Motorcycle Watercraft Sport Boat

Categories: Marketing/Merchandising, Personal Vehicles

Similar?
Yes 0 No 0

ilovedeepcreek.com
Deep Creek Lake Real Estate | Browse Homes For Sale | Jay Ferguson
Search Deep Creek Lake, MD Real Estate for sale. Jay Ferguson has been helping clients find the perfect Deep Creek property since 2000.
Welcome to Deep Creek Lake, MD and Taylor-Made Deep Creek Vacations -- check out our amazing selection of vacation rentals and homes for sale.

Categories: Travel, Real Estate

Similar?
Yes 0 No 0

deepcreekcloud10.com
Cloud 10 Vacation Rental - Home
Cloud 10 Vacation Rental - Home - Cloud 10 Deep Creek Lake vacation rental with a full arcade, indoor pool and numerous amenities

Semrush Rank: 6,920,994
Categories: Travel, Travel

Similar?
Yes 0 No 0

allearthecotours.com
Deep Creek Lake Family Activities - All Earth Eco Tours
Family Adventures Art Environmental Learning Camp Deep Creek Lake in Garrett County Maryland. Program schedule, activity information, photo gallery progressive media links.

Categories: Education/Reference, Travel

Similar?
Yes 0 No 0

deepcreekcamping.com
A Smokey Mountain Campground near Bryson City, NC
Enjoy a Smokey Mountain vacation at Deep Creek Tube Center & Campground, a creekside tent camping, cabin and RV park near Bryson City, NC. Tube rentals; playground, petting zoo with goats, kids fort, pavilion, creek access, camp store. Discounts for groups. 828-488-6055.

Categories: Travel, Travel

Similar?
Yes 0 No 0

goldenanchorcabins.com
The Golden Anchor Cabins: West Virginia Cabin Rentals
Find out why Golden Anchor Cabins is the best reviewed cabin rentals with hot tubs in West Virginia! Wait until you see our luxury bathrooms!

Moz DA: 29 Moz Rank: 3.5 Semrush Rank: 401,012
Categories: Travel, Travel

Similar?
Yes 0 No 0

greatsmokyscabinrentals.com
Great Smokys Cabin Rentals | Great Smoky Mountains Rental Cabins - Bryson City Luxury Cabin Rentals
Escape to the beauty and seclusion of the Great Smoky Mountains. Are you looking for luxury cabins with hot tubs and amazing views in the mountains of North Carolina? Call us to help plan your vacation.

Moz DA: 30 Moz Rank: 3.2 Semrush Rank: 285,029
Categories: Real Estate, Travel

Similar?
Yes 0 No 0

atouchofclasslimousines.com
Home - A Touch of Class Limousines
A Touch of Class Limousines takes pride in offering safe, comfortable and dependable transportation services to fit all of our client's needs and budgets. We specialize in quality transportation for all occasions. Providing one of the largest fleets in the Maryland, D.C., Virginia, West Virginia, Pennsylvania and surrounding areas, A Touch of Class Limousines can accommodate large and small groups alike.

Categories: Marketing/Merchandising, Personal Vehicles

Similar?
Yes 0 No 0

thebarnonlakeshore.com
The Barn on Lake Shore at Deep Creek Lake
Deep Creek Lake vacation rental in beautiful Western Maryland-The Barn on Lake Shore A privately-owned vacation home, ready for your next getaway. Book now!

Semrush Rank: 48,257,705
Categories: Business

Similar?
Yes 0 No 0

deepcreekmarina.com
Deep Creek Marina - New & Used Boats, Service, and Parts in McHenry, MD, near Washington D.C., Pittsburgh, Annapolis,and Baltimore
Deep Creek Marina is a Marine dealer in McHenry, MD featuring Axis, Harris, Malibu, Manitou, Regal, Sea Ray and Tahoe Boats and Pontoons. We offer parts, rentals, service and financing and we are conveniently located near Baltimore, Pittsburgh, Annapolis and Washington D.C.

Semrush Rank: 267,391 Facebook ♡: 136
Categories: Business, Personal Vehicles

Similar?
Yes 0 No 0

bluemoonrehoboth.com
Exceptional Fine Dining & Entertainment in Downtown Rehoboth Beach | Blue Moon
Looking for a fun, yet sophisticated restaurant run by fascinating people who nourish your appetite - and a whole lot more? Dine in style at the Blue

Categories: Entertainment, Business

Similar?
Yes 0 No 0

hthva.com
Hot Tub Heaven Vacation Cabins, Virginia Cabin Rental
Hot Tub Heaven Cabin has its own hot tub, free Internet and onsite massage therapy is available. All you need to bring are yourselves, clothes and your

Moz DA: 21 Moz Rank: 3.2 Semrush Rank: 801,345 Facebook ♡: 2,429
Categories: Recreation/Pets, Recreation/Travel, Society/Religion and Spirituality, Real Estate, ???

Similar?
Yes 0 No 0

garrettheritage.com
Home - Garrett County Chamber of Commerce, MD
Home - Garrett County Chamber of Commerce, MD

Semrush Rank: 1,543,759
Categories: Business, Travel

Similar?
Yes 0 No 0

twintailseventfarm.com
Twin Tails Event Farm | A Western Maryland Event Venue in the Deep Creek Lake Area
The quintessential country setting, along Maryland's Scenic Route in iconic Pleasant Valley, with rolling hills, green pastures and the setting sun over mountain tops, Twin Tails Event Farm in the Deep Creek Lake Area.

Semrush Rank: 3,399,886
Categories: Blogs/Wiki, Information Technology

Similar?
Yes 0 No 0

hartzellhouse.com
Hartzell House Bed & Breakfast near Fallingwater & Deep Creek Lake
Hartzell House Bed & Breakfast near Fallingwater & Deep Creek Lake

Semrush Rank: 3,453,671
Categories: Travel, Travel

Similar?
Yes 0 No 0

humblehouses.com
Home ~ Humble Houses
Do You Have A Tiny House Project We Can Help With? Get a free quote
Specialists In Tiny Home Construction
We are experts in design and construction of tiny houses and small recreational structures!

Multiple Floor Plans

Full

Categories: Parked Domain, Real Estate

Similar?
Yes 0 No 0

bumblebeervparkandcampground.com
Bumble Bee RV Park & Campground
Bumble Bee RV Park & Campground

Categories: Recreation/Hobbies, Travel

Similar?
Yes 0 No 0

deepcreeklakefamilyactivities.com
Deep Creek Lake Family Activities - All Earth Eco Tours
Family Adventures Art Environmental Learning Camp Deep Creek Lake in Garrett County Maryland. Program schedule, activity information, photo gallery progressive media links.

Categories: Recreation/Hobbies, Travel

Similar?
Yes 0 No 0

thetreehousecamp.com
Camping in Maryland & Tree House Rental | Maple Tree Campground, MD
A truly unique Maryland camping experience! Campground offers rental of rustic Tree Houses, year-round Tree Cottages, a Hobbit House and wooded tent camp sites. Near Appalachian Trail, Potomac River & more.

Categories: Recreation/Hobbies, Sports

Similar?
Yes 0 No 0

highmountainsports.com
Bikes, skis, snowboards, paddle boards, and kayak store in Western Maryland
High Mountain Sports is a four season retail sporting goods venture located in Western Maryland. In addition to selling the gear and accessories that help you excel in the outdoor world, we also offer rentals and services for bikes, skis, snowboards, paddle boards, kayaks, tubes and more!

Semrush Rank: 773,042 Facebook ♡: 1,293
Categories: Business, Recreation/Travel, Business/Consumer Goods and Services, Online Shopping, Business

Similar?
Yes 0 No 0

deepcreekuno.com
Uno Restaurant, Bar and Grill in Deep Creek Lake, Maryland
Restaurant, Bar and Grill in Deep Creek Lake Maryland featuring Steaks, Seafood, and Pizza.

Categories: Restaurants, Restaurant and Dining

Similar?
Yes 0 No 0

cabinsondeepcreek.com
Budget Friendly Cabin Rentals at Bryson City NC Campground on Deep Creek
Wide variety of affordable rustic and modern cabins at Deep Creek Tube Center and Campground, a family camping, cabin and RV vacation destination near Bryson City, NC. Group lodging in our farmhouse cabin. Some cabins under $80 per day.

Semrush Rank: 1,852,426
Categories: Marketing/Merchandising, Travel

Similar?
Yes 0 No 0

bluemoonbakery.net
Blue Moon Bakery Silverthorne, CO 80435
best restaurant silverthorne breakfast lunch cakes cookies desserts wedding cakes best bakery best dessert Blue Moon Bakery home of Reil Mountain Confections. Located in Silverthorne, CO. Wedding cakes, all occaison cakes, fresh baked bread, sandwichs and more. Best Wedding cakes in Summit County. Voted Best Dessert and best Bakery in Summit County.

Categories: Restaurants, Restaurant and Dining

Similar?
Yes 0 No 0

billsmarineservice.com
Bill's Marine Service - New & Used Boats Sales, Rentals, Service, and Parts with locations in Oakland, McHenry, and Swanton, MD
Bill's Marine Service with locations in Maryland, featuring new and used boats for sales, rentals, services, and parts in Maryland

Categories: Marketing/Merchandising, Sports

Similar?
Yes 0 No 0

dclakelife.com
The Best Fleet on Deep Creek lake | Like Life Boat Rentals
Looking to have fun on Deep Creek Lake? Come rent a boat from the team here at Lake Life Boat Rentals. We’re all about having a great time and getting wet! For this, we offer you a full range of accessories to add to your motor boat rental, such as water skis, wakeboards and more.

Semrush Rank: 397,129
Categories: Marketing/Merchandising, Personal Vehicles

Similar?
Yes 0 No 0

bluemoonrisingband.com
Blue Moon Rising
Blue Moon Rising is a nationally touring band from East Tennessee comprised of Chris West, Keith Garrett, Justin Jenkins, Randall Massengill, Tim Tipton, and Brandon Bostic.

Categories: Entertainment, Entertainment

Similar?
Yes 0 No 0

Suggest Site to this list (bluemoonrising.org)

Please only suggest if the website is similar. We do check suggested websites carefully and only approve if it's completely similar.

Site Url

Why do you think it is similar?

Email address We'll never share your email with anyone else. You'll get a confirmation email.

3 (times) seven

I'm sure it's similar Yes

bluemoonrising.org Reviews

No reviews have been made yet.

What is sitelike.org?

sitelike.org is a free tool to search and find Similar Websites, alternatives or related to the given site.
It helps you to find similar sites based on keyword overlap and shared audience.
Our team is manually checking and finding similar websites and also our visitors are helping us to find the best similar websites.
"Similar sites like" first finds the best and top keywords for all websites and rank them.
We also use our internal algorithm with analysing the website contents and also several web sources to determine the main topics of websites which are used to find similar websites that have the closest matching set of topics. Our ranking system uses user generated content created by our team, our visitors and also our algorithm.