Similar sites like carinsurancetexas.com

Texas Car Insurance - Car Insurance Texas - Fredericksburg Insurance - Kerville Insurance - Citizens Insurance Agency

Citizens Insurance Agency is an independent agency that offers online information and quotes between top companies like Germania, Hocheim Praire, Travelers, The Hartford and Progressive.

Categories: Business, Finance and Banking
Topics: auto insurance, brady, business & commercial insurance, car insurance texas, citizens insurance agency, fredericksburg insurance, health insurance, homeowners insurance, kerville insurance, life insurance, mason, texas car insurance, tx

carinsurancetexas.com Reviews

Sites similar to carinsurancetexas.com - Top 63 carinsurancetexas.com alternatives

texascarinsurancepros.com
Texas Car Insurance - Compare Texas Auto Insurance Rate Quotes
Get Texas car insurance quotes and compare rates of many TX car insurance companies. Texas auto insurance information.

Similar?
Yes 0 No 0

zar-law.com
Home - Zar Law PLLC
We’ve Helped Recover Millions for Our Clients – Get Help Today!

Semrush Rank: 15,364,996
Categories: Business, Business

Similar?
Yes 0 No 0

justautoins.com
Just Auto Insurance - Living Just in 5 minutes
Just Auto Insurance - Living Just in 5 minutes

Categories: Marketing/Merchandising, Finance and Banking

Similar?
Yes 0 No 0

costlowinsurance.com
Independent Insurance Agency in Dallas & Fort Worth, TX | Costlow Insurance
Call For Free Quote

Categories: Finance/Banking, Business

Similar?
Yes 0 No 0

insureaustin.com
Austin, TX Insurance Agents | Heaton Bennett Insurance | Texas
Heaton Bennett Insurance is your one stop shop for all your insurance needs. Reach out to us as we serve the great state of Texas and are proud to help our fellow Texans.

Semrush Rank: 2,502,383
Categories: Business, Finance and Banking

Similar?
Yes 0 No 0

texassure.com
TexasSure Vehicle Insurance Verification
TexasSure Vehicle Insurance Verification.

Facebook ♡: 11
Categories: Government/Military, Finance and Banking

Similar?
Yes 0 No 0

joelopezlaw.com
Austin Personal Injury Lawyer > 2021 Injury Attorney Austin TX
If you've be injured at the hands of someone else, contact experienced Austin personal injury attorney Joe Lopez for a free consultation today. 512.580.9962

Semrush Rank: 1,393,729
Categories: Business, Business

Similar?
Yes 0 No 0

eagleinsuredadvisors.com
Become An Independent Insurance Agent | Eagle Insured Advisors
Eagle Insured Advisors provides top level training for people that want to start their own insurance business and achieve financial success.

Semrush Rank: 35,171,517
Categories: Finance/Banking, Business

Similar?
Yes 0 No 0

thestreetlawfirm.com
Dallas, TX Liquor Liability & Car Accidents Attorneys | The Messina Law Firm, PC
If you need legal guidance for a liquor liability issue or car accident, contact our team of attorneys at The Messina Law Firm, PC in Dallas, Texas today.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

iicmva.com
IICMVA Home
IICMVA Home

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

sigbcs.com
Home - Service Insurance Group Company
Home - Service Insurance Group Company

Semrush Rank: 1,393,151
Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

grandprairietrafficticketlawyer.com
Grand Prairie Traffic Ticket Lawyer | Warrants Lifted Attorney Texas |
Grand Prairie Traffic Ticket Lawyer | Warrants Lifted Attorney Texas |

Categories: Marketing/Merchandising, Newly Observed Domain

Similar?
Yes 0 No 0

713auto.com
ABC Insurance Services | Insuring Houston & Texas
Compare multiple insurance quotes from your local independent insurance agent today. ABC Insurance Services provides Auto / Car Insurance, Home Insurance, and Business / Commercial Insurance for all of Texas.

Moz DA: 25 Moz Rank: 3.1 Semrush Rank: 2,125,666 Facebook ♡: 75
Categories: Marketing/Merchandising, Finance and Banking

Similar?
Yes 0 No 0

rosslawgroup.com
Ross • Scalise Employment Lawyers | Employment Lawyers | Austin, TX
Employment lawyers successfully fighting for our clients since 1998. When employers do not obey these laws and regulations, employees have the right to take action without employer retaliation. Ross • Scalise Employment Lawyers is committed to helping workers by upholding the law and holding companies accountable for their actions. If your employer has discriminated against you, harassed you, retaliated against you for complaining about illegal actions, stolen your wages, or otherwise wronged you, talk to a seasoned Texas employment lawyer at our firm today.

Semrush Rank: 823,814
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

jkplaw.com
Kostura & Putman, P.C. - Seeking Justice for Families & Individuals
Kostura & Putman Law is an Austin, Texas law firm that combines experience & leadership to achieve results for our clients.

Categories: Business, Business

Similar?
Yes 0 No 0

caglefirm.com
Austin Personal Injury Attorney | The Cagle Law Firm, P.C.
Experienced Austin, Texas personal injury lawyers. You're more than 'just a case' to us—let's find out what your case is worth! NO fee unless we win your case.

Semrush Rank: 2,339,535
Categories: Business, Business

Similar?
Yes 0 No 0

texasins.net
Texas Insurance Agency
Texas Insurance Agency is a local independent insurance agency that specializes in personal and business insurance. Call us at 903-675-5751.

Semrush Rank: 970,130
Categories: Finance/Banking, Business

Similar?
Yes 0 No 0

amaxinsurance.com
A-MAX Auto Insurance | Affordable Car Insurance
Find affordable auto insurance rates and compare quotes from 30+ carriers with A-MAX. Get a free quote online or speak with an agent. Call (800) 921-2629!

Moz DA: 32 Moz Rank: 4.1 Semrush Rank: 22,555 Facebook ♡: 2
Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

masson.us
A Citizen's Guide to Indiana – Masson's Blog
Masson's Blog

Categories: Personal Pages, Personal Websites and Blogs

Similar?
Yes 0 No 0

minsuranceagent.com
Home, Auto & Life Insurance Agency in McKinney | Mauceri-Bynum Insurance
Mauceri Bynum Insurance is dedicated to provide top quality insurance plans for all walks of life and needs. Call 214-733-8400 to speak with us today.

Semrush Rank: 2,813,760
Categories: Finance/Banking, Business

Similar?
Yes 0 No 0

douggoyen.com
Dallas Injury Lawyer | Texas Injury Attorneys | Law Office of Doug Goyen
Injured in a car accident? No Fee Unless We Win! Top Dallas injury lawyer Doug Goyen will get you the treatment you need for your injury and the compensation you deserve. If you were injured in a car accident, truck accident, or any other injury case call 972-599-4100 - Free Case Reviews

Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

jonesinsurance.com
Home | Jones & Associates Insurance
Home | Jones & Associates Insurance

Moz DA: 12 Moz Rank: 3 Semrush Rank: 2,996,762 Facebook ♡: 348
Categories: Marketing/Merchandising, Finance and Banking

Similar?
Yes 0 No 0

eebins.com
Evans, Ewan & Brady Insurance Agency, Inc. located in Georgetown, Texas
Evans, Ewan & Brady Insurance Agency, Inc. is a local independent insurance agency located in Georgetown, Texas. Call us at 512-869-1511.

Categories: Business, Finance and Banking

Similar?
Yes 0 No 0

aiminsuranceoftexas.com
Home - AIM Insurance of Texas
Home - AIM Insurance of Texas

Categories: Business, Shopping

Similar?
Yes 0 No 0

a-abana.com
Texas & Vegas Cheap Auto Insurance | A Abana Insurance
Do you need car insurance in Texas? A-Abana offers affordable rates and a free quote. Proudly serving the Latino community since 1975.

Moz DA: 30 Moz Rank: 3.8 Semrush Rank: 187,722
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

iiat.org
Independent Insurance Agents of Texas | IIAT
The Independent Insurance Agents of Texas (IIAT) expands the value and influence of independent insurance agencies via advocacy, information, training,…

Facebook ♡: 8
Categories: Business, Brokerage and Trading

Similar?
Yes 0 No 0

civtrial.com
Austin Personal Injury Lawyer, Car Accident Attorney
Your personal injury case is different. Don't settle for less no fee unless you win We handle the insurance companies so you can have your life back. Start by meeting with an experienced attorney who will work on your case When we offer a free consultation, we mean one with a lawyer. A lawyer with

Moz DA: 24 Moz Rank: 3.4 Semrush Rank: 2,104,178
Categories: Business, Business

Similar?
Yes 0 No 0

helpinsure.com
HelpInsure - HelpInsure
HelpInsure - HelpInsure

Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

beltzlaw.com
Beltz Law Firm | Dallas Traffic Ticket, Accident & Criminal Attorney
Beltz Law Firm is a top rated Dallas Law Firm. We provide legal services for injury cases, traffic tickets, criminal defense, and DUI as well as DWI.

Moz DA: 22 Moz Rank: 3.7 Semrush Rank: 637,049
Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

mansfieldtexas.gov
Mansfield, TX | Official Website
Mansfield, TX | Official Website

Semrush Rank: 38,601
Categories: Public Information, Government and Legal Organizations

Similar?
Yes 0 No 0

texasinsuranceplace.com
Texas Insurance Place - Commercial General Liability
Texas Insurance Place is your #1 source for affordable commercial general liability in Texas. Free general liability quotes for business owners. We specialize in HVAC, Air Conditioning, Electricians, Master Plumbers, AC, Electrical and Plumbing contractor insurance.

Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

texasquotes.com
Texas Quotes | Insurance Quotes for Texans
Insurance Quotes in Texas are different. Our site has a unique database to help you find the cheapest insurance in Texas. Get a free insurance quote online.

Facebook ♡: 0
Categories: Finance/Banking, Advertising

Similar?
Yes 0 No 0

texasinsuranceagency.net
Texas Insurance Agency | Auto Home SR-22 Insurance
Texas Insurance Agency is a full service agency based in Houston specializing in auto insurance, homeowners insurance, commercial vehicle insurance, SR-22, renters insurance, and more. We gotcha covered with the best rates online.

Categories: Business, Business

Similar?
Yes 0 No 0

akhtarlaw.com
Texas Personal Injury, Business Law, and Consumer Protection Law Firm | Akhtarlaw.com
The Akhtar Law Firm, based in Austin, Texas, specializes in providing personal injury, business law, and consumer protection legal services.

Semrush Rank: 14,513,231
Categories: Business, Political Organizations

Similar?
Yes 0 No 0

texasclassicinsurance.com
Granbury, TX Insurance Agents | Texas Classic Insurance | Texas
Texas Classic Insurance in Granbury, TX can help Texas residents find the right amount of insurance coverage to fit their needs.

Semrush Rank: 2,392,188
Categories: Finance/Banking, Business

Similar?
Yes 0 No 0

dallastexaspersonalinjurylawyers.com
Site is not available
Site is not available

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

greenway-ins.com
Home - Greenway Insurance
Home - Greenway Insurance

Semrush Rank: 14,618,390 Facebook ♡: 496
Categories: Business, Business

Similar?
Yes 0 No 0

farmersvilletx.com
Farmersville, TX
Farmersville, TX

Moz DA: 36 Moz Rank: 3.7 Semrush Rank: 140,585 Facebook ♡: 1,595
Categories: Public Information, Reference

Similar?
Yes 0 No 0

decaturpubliclibrary.com
Decatur Public Library | Decatur, TX - Official Website
The Decatur Public Library provides a wide range of materials available for checkout including books, DVDs, audiobooks, libros en espanol, and large print books.

Categories: Education/Reference, Reference

Similar?
Yes 0 No 0

mesquitetrafficticketlawyer.com
Mesquite Traffic Ticket Lawyer | Mesquite Speeding Attorney
We are Mesquite traffic ticket attorneys that assist clients in the DFW area with all types of cases, which include speeding tickets, warrants, suspended

Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

texas-home-insurance.net
Texas-Home-Insurance.net - Low cost Texas Home Insurance Quotes, save money on your TX homeowners insurance, lowest Texas home insurance rates.
Texas-Home-Insurance.net - Low cost Texas Home Insurance Quotes, save money on your TX homeowners insurance, lowest Texas home insurance rates.

Semrush Rank: 34,412,282
Categories: Finance/Banking, Business

Similar?
Yes 0 No 0

tylawrenceinsurance.com

Home & Auto Insurance - Dripping Springs TX/Lakeway TX - Ty Lawrence Insurance Agency - Ty Lawrence Insurance Agency

Auto Insurance, Home Insurance, Business Insurance, Life and Health Insurance in Dripping Springs, Lakeway, Bee Cave, West Lake Hills, Driftwood and Wimberley.

Semrush Rank: 3,047,151
Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

quotetexas.com
Business & Commercial Insurance Agency - Dallas/Fort Worth, Houston, Austin, San Antonio, TX
Commercial Insurance Prices from 65 carriers with one request. Fast, competitive, easy! Quote Texas Insurance makes insurance simple.

Moz DA: 22 Moz Rank: 3.5 Semrush Rank: 852,282
Categories: Business, Finance and Banking

Similar?
Yes 0 No 0

colleylaw.net
Austin Car Accident Lawyer | Colley Firm, P.C.
We are experienced Austin car accident lawyers who will fight to get you the compensation that covers ALL your losses and injuries! ***FREE CONSULTATION***

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

duidefense.com
DUI Defense | Hire an Experienced DUI Attorney
Jon Scott Fox is an experience DUI defense attorney in Washington State. Located in Bellevue he will protect your legal rights statewide.

Categories: Business, Reference

Similar?
Yes 0 No 0

insuranceagencytexas.com
Commercial Business Insurance Agency Pearland & Katy & Houston TX
Commercial Business Insurance Agency Pearland & Katy & Houston TX | Texas Insurance Agency. Call us today (281) 398-1010 We are here for you.

Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

dmv-defenders.com
California DMV Defense - Non Attorney/Lawyer DMV Defense
Our experienced team is your DMV Hearing Defense solution. We are expert DMV Defense advocates & can successfully represent in all aspects of DMV Defense.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

sbrownlawyer.com
Pearland Family Law Lawyer | Criminal Defense | Angleton, TX
Texas family law attorneys & divorce lawyers serving Angleton, TX and nearby areas. Criminal defense & personal injury attorneys in Pearland & Houston TX.

Semrush Rank: 1,076,449
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

fsgattorneys.com
Fort Thomas Attorneys | Criminal Defense, Personal Injury
Located in Fort Thomas, Fessler, Schneider & Grimme LLP, provides personalized services to individuals, families and businesses in Kentucky and Ohio. Free consults. 859-291-9075.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

insuranceinstitute.org
Insurance Institute of Indiana
Insurance Institute of Indiana

Facebook ♡: 0

Similar?
Yes 0 No 0

tatelawoffices.com
Dallas Personal Injury Law Firm Texas | Free Consultations. Call us 24/7!
Injured? Tate Law Offices, a personal injury law firm in Texas, can help you recover lost wages & compensation! Call now. Habla Español.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

whamandrogers.com
Board Certified Injury Lawyers - Wham & Rogers
From suffering life-changing injuries to dealing with the sudden loss of a loved one, The Woodlands and Spring personal injury lawyers do all that is possible to help you secure the justice and the full amount of financial compensation you deserve.

Semrush Rank: 1,967,401
Categories: Business, Business

Similar?
Yes 0 No 0

rhsb.com
Roach Howard Smith & Barton
Roach Howard Smith & Barton

Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

texasgeneralinsurance.com
Home - Second Western Insurance
Insurance Coverage for All Businesses Free Coverage Review and Policy Service | Licensed Insurance Company Speak with a licensed insurance agent: (210)

Categories: Marketing/Merchandising, Finance and Banking

Similar?
Yes 0 No 0

anco.com
ANCO Insurance
ANCO Insurance provides employee benefits, business, and personal insurance solutions for Texas and all 50 states. Start your quote today!

Moz DA: 27 Moz Rank: 3.5 Semrush Rank: 1,102,630 Facebook ♡: 1,418
Categories: Finance/Banking, Business

Similar?
Yes 0 No 0

morrowsheppard.com
Houston Personal Injury Lawyers | Morrow & Sheppard LLP
The award-winning Houston personal injury lawyers at Morrow & Sheppard, LLP represent victims of all types of injuries. Schedule your FREE consultation today.

Semrush Rank: 477,044 Facebook ♡: 656
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

mybiginsurance.com
Biscoe Insurance - Your Austin Auto, Home, and Life Insurance Company
Looking for an Austin Insurance Company? Visit Biscoe Insurance Group to explore our wide variety of insurance services in Austin, TX. Call Today (512) 388-2121

Semrush Rank: 16,269,970
Categories: Finance/Banking, Business

Similar?
Yes 0 No 0

learnandserve.org
Best Auto Insurance In Colorado Springs, Colorado-Your Guide To Affordable Rates In 2023
2023 -Auto Insurance in Colorado Springs, Home, & Motorcycle Insurance. Prices starting at $45 per month. Online Quotes or Live agent quotes in minutes. Auto Insurance in Colorado and 34 more states

Moz DA: 69 Moz Rank: 4.8 Semrush Rank: 159,786 Facebook ♡: 2
Categories: Education/Reference, Education

Similar?
Yes 0 No 0

txinsurancepro.com
Texas Insurance Pro - Your professional insurance resource
Texas Insurance Pro - Your professional insurance resource

Categories: Business, Finance and Banking

Similar?
Yes 0 No 0

fullcoverageautoinsurances.com
Full Coverage Auto Insurance
Compare cheap full coverage auto insurance quotes for free. We help you decide what coverage is right for you. There is no obligation and save instantly.

Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

troymetroagency.com
Troy-Metro Agency
Troy-Metro Agency is a local independent insurance agency located in Troy, Michigan. Call us at 248-813-8540.

Semrush Rank: 2,349,084
Categories: Business, Business

Similar?
Yes 0 No 0

mytexasinjurylawyers.com
Top-Rated Texas Personal Injury Lawyers - Sutliff & Stout Injury & Accident Law Firm
If you or a loved has been injured in an accident, we want to help. ✅Call 24/7 for a FREE consultation: 📞(713) 987-7111

Categories: Business, Business

Similar?
Yes 0 No 0

mitchellandabbott.com
Hamilton Insurance Brokers | The Mitchell & Abbott Group Insurance Brokers Ltd.
Our mission is simple: We want to earn the right to be your insurance broker by providing you with a wide selection of insurance products and choices, from auto insurance to property insurance and beyond..

Categories: Business, Finance and Banking

Similar?
Yes 0 No 0

Suggest Site to this list (carinsurancetexas.com)

Please only suggest if the website is similar. We do check suggested websites carefully and only approve if it's completely similar.

Site Url

Why do you think it is similar?

Email address We'll never share your email with anyone else. You'll get a confirmation email.

3 (times) seven

I'm sure it's similar Yes

carinsurancetexas.com Reviews

No reviews have been made yet.

What is sitelike.org?

sitelike.org is a free tool to search and find Similar Websites, alternatives or related to the given site.
It helps you to find similar sites based on keyword overlap and shared audience.
Our team is manually checking and finding similar websites and also our visitors are helping us to find the best similar websites.
"Similar sites like" first finds the best and top keywords for all websites and rank them.
We also use our internal algorithm with analysing the website contents and also several web sources to determine the main topics of websites which are used to find similar websites that have the closest matching set of topics. Our ranking system uses user generated content created by our team, our visitors and also our algorithm.