Similar sites like deantsourakis.com

Clearwater Criminal Defense Attorney - Dean G. Tsourakis

Dean Tsourakis is a Clearwater criminal defense attorney with over 40 years of experience. Contact us to schedule a free consultation.

Categories: Marketing/Merchandising, Business
Topics: clearwater criminal defense attorney, dean g. tsourakis

Moz DA: 22 Moz Rank: 3.3 Semrush Rank: 255,844

deantsourakis.com Reviews

Sites similar to deantsourakis.com - Top 51 deantsourakis.com alternatives

ladanlaw.com
Orlando Criminal Defense Lawyer - The Ladan Law Firm, P.A.
Discover why Amir Ladan is one of the Best Criminal Defense Attorneys in Orlando. Contact Us For A Free Case Review. Speak to a lawyer today.

Semrush Rank: 1,903,272
Categories: Business, Political Organizations

Similar?
Yes 0 No 0

clearwaterflcriminaldefense.com
Clearwater Criminal Defense Attorney | The Law Office of Timothy Hessinger
With over fifteen years of experience as a state prosecutor, the Clearwater criminal lawyer at The Law Office of Timothy Hessinger can powerfully defend your case. Call today!

Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

kirkpinkerton.com
WordPress › Error
WordPress › Error

Moz DA: 29 Moz Rank: 3.1 Semrush Rank: 17,777,722 Facebook ♡: 373
Categories: Business, Business

Similar?
Yes 0 No 0

theticketlawyers.com
Home - For DUI, Traffic & Speeding Ticket in Florida.
Home - For DUI, Traffic & Speeding Ticket in Florida.

Semrush Rank: 446,472
Categories: Business, Business

Similar?
Yes 0 No 0

cananlaw.com
St. Augustine Attorneys | Personal Injury & Litigation Firm | Canan Law
Life's not perfect. We're here to help. Find out how Canan Law in Northeast Florida can help you today. Call for a free consultation.

Facebook ♡: 0
Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

manderlawgroup.com
Dade City Attorneys
The Dade City attorneys of Mander Law Group help personal injury, criminal defense, family law, estate planning, real estate & business clients.

Semrush Rank: 792,703 Facebook ♡: 986
Categories: Business, Political Organizations

Similar?
Yes 0 No 0

tmplegal.com
Clearwater Attorneys | Tinny, Meyer & Piccarreto, P.A.
Tinny, Meyer & Piccarreto, P.A. is a family law and criminal defense firm in Clearwater, Florida. Call us 24/7 to benefit from 35+ years of experience from our Clearwater lawyers.

Semrush Rank: 2,953,029
Categories: Marketing/Merchandising, Shopping

Similar?
Yes 0 No 0

accidentshappenatty.com
Welcome | Laporte, Mulligan & Werner-Watkins (LMW) Attorneys at Law
LMW Attorneys at Law provides outstanding legal representation for personal injury & criminal defense. Schedule your free consultation today!

Semrush Rank: 264,863
Categories: Business, Business

Similar?
Yes 0 No 0

criminaldefenseattorneytampa.com
Attorneys for Criminal Defense & DUI in Tampa, FL | Call 813-250-0500
The five criminal defense attorneys at Sammis Law Firm fight felony, misdemeanor, and DUI cases in Tampa, Hillsborough County.

Facebook ♡: 89
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

megajustice.com
Pawlowski//Mastrilli Law Group
Our Tampa lawyers can help whether you have been injured in a car, truck or motorcycle accident, work accident, or other unfortunate reason.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

blakedorstenlaw.com
Clearwater Criminal Defense Lawyers | St. Petersburg DUI & Drug Crime Attorneys | Blake & Dorsten, P.A.
Available 24/7 - Call 727-286-6141 - Blake & Dorsten, P.A. aggressively represents the accused against charges in Criminal Defense, DUI & Drug Crime cases.

Facebook ♡: 0
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

labaradams.com
Home | LABARADAMS
LaBar & Adams, P.A. is committed to seeking justice for Employees and those injured due to the negligence of another.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

rubertlaw.com
Miami Alcohol & Liquor License Law Attorney | Broward County
Alcoholic beverage law presents unique legal issues for Florida business owners and entrepreneurs. At Samuel A. Rubert, P.A., we can assist: 954-546-7661.

Semrush Rank: 6,732,889
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

drug2go.com
Tampa Drug Lawyer - Tampa Drug Lawyer
Drug Crimes Defense Call 813-222-2220 If you or someone you know is facing drug-related charges in Tampa Bay, it’s important to seek out a skilled and experienced drug crimes defense attorney. W.F. “Casey” Ebsary, Jr, also known as Casey the Lawyer, is an attorney who has dedicated his career to defending individuals who have been […]

Categories: Blogs/Wiki, Information Technology

Similar?
Yes 0 No 0

saltlakeduidefense.com

Semrush Rank: 37,637,228
Categories: Business, Business

Similar?
Yes 0 No 0

toomuchatstake.com
Law Firm in Florida | Brooks, LeBoeuf, Foster & Gwartney, P.A.
Here For You When There Is Too Much At Stake To Go With Anyone Else Schedule your free consultation today When there is too much at stake on your case, you need a team of local legal experts to advocate for you and your loved ones. If you need an attorney, please do not make

Categories: Business, Business

Similar?
Yes 0 No 0

mykramerlawfirm.com
Orlando Divorce Lawyers | Recognized as Best Lawyers in Orlando*
Orlando's attorneys at Kramer Law offer legal help with divorce, personal injury, business law, estate law, family law and foreclosure defense.

Moz DA: 30 Moz Rank: 3.8 Semrush Rank: 769,759
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

richardhornsby.com
Orlando Criminal Defense Attorney Richard Hornsby
Orlando criminal defense lawyer Richard Hornsby (407-540-1551) represents criminal defense, DUI, and juvenile clients in Central Florida and the greater Orlando area.

Moz DA: 47 Moz Rank: 3.9 Facebook ♡: 0
Categories: Non-Profit/Advocacy/NGO, Government and Legal Organizations

Similar?
Yes 0 No 0

mcguirelawoffices.com
Home ⋆ McGuire Law Offices Serving Clearwater, Pinellas County and Tampa Bay Florida
Clearwater-Tampa Bay Area Lawyers specializing in divorce, car accidents, personal injury, bankruptcy, and criminal law, DUI

Semrush Rank: 1,592,833
Categories: Business, ???

Similar?
Yes 0 No 0

careyandleisure.com
Clearwater, FL Personal Injury Attorneys | Carey Leisure & Neal
At Carey Leisure & Neal, we vow an unwavering commitment to obtain the most compensation possible in your personal injury case, car accident, or medical malpractice case.

Moz DA: 28 Moz Rank: 3.9 Semrush Rank: 194,819
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

destinattorneyjohngreene.com
Destin Attorney | Criminal Defense Lawyer, Divorce, and Bankruptcy
John F. Greene Attorney at Law, based in Destin Florida offers sound legal advice and representation in Divorce, Criminal Defense, Bankruptcy, and more.

Semrush Rank: 1,242,222
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

gabriellawteam.com
Jupiter Criminal Defense Attorney | Experienced Criminal Lawyer in Jupiter, FL
Jupiter criminal defense attorney Brian Gabriel has over 30 years of experience in defending clients facing criminal charges such as DUI, drug possession, juvenile acts, & more.

Semrush Rank: 377,717 Facebook ♡: 562
Categories: Business, Business

Similar?
Yes 0 No 0

husseinandwebber.com
Criminal Attorneys | Hussein & Webber, PL
Hussein & Webber, PL is a criminal defense law firm with offices in Jacksonville and Orlando, Florida.

Semrush Rank: 75,548
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

drizislaw.com
Home - Law Office of Johnny D. Drizis P.A. | Family Law Clearwater, FL
The Law Office of Johnny D. Drizis P.A. in Clearwater, Florida. Family law and divorce attorneys who care about you and take the time to listen. Family Law Clearwater.

Semrush Rank: 3,386,910
Categories: Business, Business

Similar?
Yes 0 No 0

7citieslaw.com
7 Cities Law — Full service law firm in Hampton Roads specializing in criminal defense.
Full-service law firm in Hampton Roads specializing in criminal defense, s*xual assault defense, juvenile law, traffic law, and appeals. Serving Virginia Beach, Norfolk, Hampton, Suffolk, Portsmouth, Chesapeake, Newport News, and the Eastern Shore.

Semrush Rank: 2,662,650
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

scsolicitor5.org
5th Circuit Solicitor's Office, SC
The 5th Circuit Solicitor’s Office delivers justice through the fair & diligent prosecution of citizens charged with criminal offenses in our jurisdiction.

Semrush Rank: 797,582
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

mosesandrooth.com
Orlando Criminal Defense Lawyers Moses & Rooth
The criminal defense lawyers at Moses & Rooth are proud to serve Orlando. We handle a variety of criminal matters. Let us work for you!

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

tampacriminalattorneys.com
Tampa Criminal Defense & DUI Lawyers | Thomas & Paulk
Get a FREE case evaluation with Tampa criminal defense & DUI attorneys at Thomas & Paulk. Thousands of cases handled. Decades of experience. Available 24/7!

Moz DA: 26 Moz Rank: 3.3 Semrush Rank: 366,793
Categories: Business, Business

Similar?
Yes 0 No 0

tampaflcriminaldefenselawyers.com
Criminal Defense Lawyer | St. Petersburg | The Law Office of Timothy Hessinger
The St. Petersburg criminal defense attorney at The Law Office of Timothy Hessinger is former prosecutor with 15+ years' experience. Free consultation!

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

psffirm.com
Top Criminal Defense Attorneys in Clearwater and Tampa Bay
The best Criminal Defense attorneys in Clearwater and Tampa Bay. Experienced legal representation for criminal law.

Categories: Business, Business

Similar?
Yes 0 No 0

thelowrylawfirm.com
The Lowry Law Firm Jefferson County MO
Michael Lowry, Sarah Donahue and Tim Pudlowski have extensive experience in Criminal Defense, Family Law, Personal Injury, and Workers’ Compensation claims.

Semrush Rank: 2,236,694
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

galehmoore.com
Clearwater Divorce Attorney
Clearwater divorce attorney, Gale H. Moore, guides clients through divorce and family law matters, such as child custody, alimony, and property division.

Semrush Rank: 1,334,375
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

normlfl.org
NORML of Florida | Working to Reform Marijuana Laws
Together We Will Change The Rules Together We Will Change The Law center no-repeat;center top;; Memberships Basic Supporter $25.00 Gold Leaf Lapel Pin Regular Supporter $35.00 T-Shirt Family Supporter $60.00 2-T-Shirts Choose Your Membership https://normlfl.org/memberships/ box Make a Donation YOUR MONEY WILL HELP NORML supports the adoption of a legally controlled market for marijuana, where consumers can buy marijuana for personal use from a safe legal source. We will continue to push Congress to amend federal law to permit states to experiment with different models of marijuana legalization without interference from the federal government. Donate Now https://normlfl.org/donations/ box Volunteer WE NEED YOU Researching and creating internal reports to support NORML's mission, providing administrative support to NORML's executive staff, leading volunteer efforts such as phone banks, voter registration drives, and door-to-door canvassing. Apply Today https://normlfl.org/become-a-volunteer/ box Sign the Petition icon-pencil-line Help Regulate Florida attain ballot status on November 6, 2018 by printing and signing the petition. Print extras to share with friends and family and mail to the address on the back. Together we can change the marijuana law in Florida. http://www.regulateflorida.com/printpetition/ 20 10 We are so excited to have medical marijuana in Florida. We wanted to make sure that you had the knowledge and the resources to know where to get it. This website is devoted to informing you in an easy to search manner where you can find a doctor that can recommend marijuana in Florida. There's also an approved dispensary tab where you can find the dispensaries where you can get that marijuana right here in Florida. Remember, currently Statewide delivery is permitted, so no matter where you live you can have access to this god-given life-saving pain-reducing Quality of Life Giving plant. Yours truly, For the Patients!! Michael C. Minardi, Esq. h

Categories: Blogs/Wiki, Business

Similar?
Yes 0 No 0

jch-palaw.com
Clearwater Divorce & Family Law Attorney | Florida Child Custody & Relocation Lawyer
In and around Clearwater, FL, Jennifer C. Harrington, P.A. represents clients in divorce, child custody and support, alimony, paternity and other family law matters.

Semrush Rank: 2,732,822
Categories: Government and Legal Organizations

Similar?
Yes 0 No 0

crs-pa.com
Family Attorney in Clearwater | Connie R. Stephens
At the law office of Connie R. Stephens, our dedicated Clearwater family law attorney can help you fight through your emotional legal matters. Call us today to learn more! Our experience ranges from divorce to child custody and support, and more!

Semrush Rank: 8,403,616
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

cedro-uva.org
CEDRO Centrum voor Drugsonderzoek
CEDRO combines epidemiological and longitudinal research on illicit drugs, addiction theory, and drug policy developments in Europe. Articles in English, Dutch, French, German, Italian and Russian.

Facebook ♡: 0
Categories: Health, General Organizations

Similar?
Yes 0 No 0

criminalattorneymelbournefl.com
The Law Offices of Bryan J. McCarthy
The Melbourne attorney at The Law Offices of Bryan J. McCarthy assists clients with criminal defense & personal injury cases. Providing aggressive representation throughout Brevard County, with over 10 years of experience; call for a free consultation.

Semrush Rank: 623,556
Categories: Business, Business

Similar?
Yes 0 No 0

thelawfirmforfamilylaw.com
Divorce Attorneys Clearwater - Family Law Lawyers FL | The Law Firm for Family Law
Family Law Attorneys Clearwater - Divorce Lawyers Clearwater, Florida - Gary Williams fully support clients and become advocates on their behalf, so their rights are protected. Call (727) 531-8737.

Semrush Rank: 1,801,570
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

clearwaterbar.org
clearwaterbar.org
clearwaterbar.org

Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

valcarcellaw.com
Sarasota Criminal Defense Lawyer | Criminal Lawyer Sarasota, Erika Valcarcel
A criminal charge doesn't have to change your life. Call Sarasota criminal defense lawyer Erika Valcarcel for a free, legal consultation: (941) 363-7900.

Semrush Rank: 775,578 Facebook ♡: 7
Categories: Business, Business

Similar?
Yes 0 No 0

skierlawfirm.com
West Palm Beach Criminal Lawyers | The Skier Law Firm, P.A.
West Palm Beach criminal defense lawyers providing aggressive representation to achieve favorable results. Call The Skier Law Firm, P.A. for a free consultation.

Semrush Rank: 864,368 Facebook ♡: 153
Categories: Computers/Internet/Searching, Computers/Software/Freeware, Society/Law, Business, Business

Similar?
Yes 0 No 0

fedsafe.com
FEDSafe - Online and In Person Driving School
Online and in person driving school offering state and country certified courses.

Semrush Rank: 385,247
Categories: Education/Reference, Education

Similar?
Yes 0 No 0

hullstreetlaw.com
Hull Street Law - Hull Street LawHull Street Law | A division of Thomas H. Roberts & Associates, P.C. - personal injury and criminal defense
Criminal and Traffic Defense in Central Virginia

Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

rflawgroup.com
Miami Criminal Lawyer
Miami criminal lawyers, Ratzan & Faccidomo, provide aggressive representation and will act fast to protect your rights and build a strong defense.

Semrush Rank: 528,814
Categories: Business, Business

Similar?
Yes 0 No 0

drugtreatment.com
Alcohol and Drug Addiction Treatment Centers - Get Help
Just another WordPress site

Facebook ♡: 52
Categories: Health, Health and Wellness

Similar?
Yes 0 No 0

pslaw.org
pslaw.org
One moment, please...

Categories: Blogs/Wiki, Business

Similar?
Yes 0 No 0

reasonabledoubt.org

Semrush Rank: 0 Facebook ♡: 17
Categories: Education/Reference, Government and Legal Organizations

Similar?
Yes 0 No 0

familydiplomacy.com
Family Diplomacy - A Collaborative Law Firm - Adam B. Cordover
We are a Collaborative divorce & family law firm helping people resolve personal disputes without destroying their families. Collaborative Family Law Firm

Semrush Rank: 4,026,815 Facebook ♡: 192
Categories: Business, Society and Lifestyles

Similar?
Yes 0 No 0

floridadriverslicenses.org
floridadriverslicenses.org
This domain may be for sale!

Facebook ♡: 0
Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

moffitt.law
Welcome to The Law Office of Philip Moffitt - The Law Office of Philip Moffitt, P.A.
*ON VACATION 8/3-8/7 2023, EMAIL OR USING ONLINE HIRING FORM FOR CIVIL TICKETS IS THE BEST WAY TO REACH ME* Experienced traffic ticket defense at an affordable

Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

visitpcfla.com
Panama City Beach, Florida
Panama City Beach, Florida

Categories: Public Information, Travel

Similar?
Yes 0 No 0

Suggest Site to this list (deantsourakis.com)

Please only suggest if the website is similar. We do check suggested websites carefully and only approve if it's completely similar.

Site Url

Why do you think it is similar?

Email address We'll never share your email with anyone else. You'll get a confirmation email.

3 (times) seven

I'm sure it's similar Yes

deantsourakis.com Reviews

No reviews have been made yet.

What is sitelike.org?

sitelike.org is a free tool to search and find Similar Websites, alternatives or related to the given site.
It helps you to find similar sites based on keyword overlap and shared audience.
Our team is manually checking and finding similar websites and also our visitors are helping us to find the best similar websites.
"Similar sites like" first finds the best and top keywords for all websites and rank them.
We also use our internal algorithm with analysing the website contents and also several web sources to determine the main topics of websites which are used to find similar websites that have the closest matching set of topics. Our ranking system uses user generated content created by our team, our visitors and also our algorithm.

36
Visited: 36 times