Similar sites like fightyourdui.com

DUI Defense Lawyers In Sarasota, Tampa, Orlando, Bradenton, and Polk County

Call our Florida DUI Lawyers at 1-800-FIGHT IT (344-4848) - The Law Offices of Finebloom and Haenel, P.A. is a DUI defense law firm servicing clients in Tampa, Sarasota, Bradenton, Orlando and all over Florida.

Categories: Business, Government and Legal Organizations
Topics: and polk county, dui defense lawyers in sarasota

fightyourdui.com Reviews

Sites similar to fightyourdui.com - Top 26 fightyourdui.com alternatives

tellcopm.com
Tellco Property Management | Professional Property Management in Clark County and Vancouver, WA, and Polk County, Independence and Monmouth, OR | Home Page
Tellco Property Management Provides Professional Property Management in the Clark County and Vancouver, WA, and Polk County, Independence and Monmouth, OR Areas. |

Categories: Real Estate, Real Estate

Similar?
Yes 0 No 0

victimimpactpanelusa.com
Victim Impact Panel
Print your victim impact panel certificate in less than an hour!

Semrush Rank: 6,652,668
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

utahduilawblog.com
Utah DUI Attorney : Salt Lake City DUI Lawyer & Attorney : Glen Neeley : Serving Davis County, Ogden, Brigham City, Logan
Utah DUI Attorney : Salt Lake City DUI Lawyer & Attorney : Glen Neeley : Serving Davis County, Ogden, Brigham City, Logan

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

myduiflorida.com
Aggressive Legal Defense by a Former Prosecutor When You've Been Accused of a Criminal, DUI, or Traffic Offense
Charged with a crime in Daytona Beach, Deland, Sanford, or elsewhere in Volusia or Seminole counties? Our Florida criminal defense law firm can advise you on DUI charges, traffic tickets, and other offenses.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

floridaduilawyer.net
Trusted DUI Lawyers/Attorneys in Florida - Florida DUI Attorney and Criminal Defense Lawyer | Law Firm
Trusted DUI Lawyers/Attorneys in Florida - Florida DUI Attorney and Criminal Defense Lawyer | Law Firm

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

duistpetersburglawyer.com
DUI Defense Attorneys in Clearwater & St. Petersburg, FL | Pinellas County | Russo Pelletier & Sullivan | DUI Defense Attorneys in St. Petersburg
If you have been arrested for a DUI, Drunk Driving, DWI, or Driving Under the Influence charge in the Tampa Bay area arising out of St. Petersburg, Clearwater, or any other location within Pinellas County, we are highly rated DUI lawyers who can help.

Categories: Business, Business

Similar?
Yes 0 No 0

tampaflduilawyer.com
DUI Attorneys in Tampa, FL | Sammis Law | 813-250-0500
After a DUI arrest in Hillsborough County, FL, contact the drunk driving defense attorneys at Sammis Law Firm in downtown Tampa.

Semrush Rank: 824,518
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

duilawdefense.com
Miami Criminal Defense Attorney | Jonathan Blecher, P.A.
If you are looking for an experienced Criminal Defense Attorney in Miami, contact Jonathan Blecher, P.A. law firm today!

Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

skyfineusa.com

Semrush Rank: 1,664,491
Categories: Business, Business

Similar?
Yes 0 No 0

850calljoe.com
850-CALL-JOE: Orlando's Premier Community Law Firm
Orlando Attorney Joseph Knape helps clients with cases from criminal defense & DUI to divorce and family law. Call & get your FREE consultation today!

Categories: Business, Business

Similar?
Yes 0 No 0

thebrineshrimp.com
The Brine Shrimp
Utah's #1 News Source!

Semrush Rank: 1,570,879
Categories: Blogs/Wiki, Arts and Culture

Similar?
Yes 0 No 0

criminalattorneystpetersburg.com
Criminal & DUI Defense Attorneys in St. Petersburg, FL
Melinda Morris, former State Prosecutor, is an experienced criminal defense and DUI lawyer serving the greater Tampa Bay area. If you are facing criminal charges, call 727-592-5885 today.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

tampaflcriminaldefenselawyers.com
Criminal Defense Lawyer | St. Petersburg | The Law Office of Timothy Hessinger
The St. Petersburg criminal defense attorney at The Law Office of Timothy Hessinger is former prosecutor with 15+ years' experience. Free consultation!

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

melbournedefenselaw.com
Criminal Attorney Melbourne FL Lawyer
Richard G. Canina, P.A., a criminal defense law office in Melbourne, Florida, handling all felony and misdemeanor cases. FREE CONSULTATIONS call 321-728-0989. Available 24/7.

Semrush Rank: 1,474,204
Categories: Business, Business

Similar?
Yes 0 No 0

fightyourcase.com
Criminal Defense Attorneys & DUI Lawyers
Finebloom Haenel and Higgins are Criminal Defense Attorneys and DUI Lawyers in Sarasota, Orlando, Tampa and Pinellas County. Call for a free consult.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

therickmanlawfirm.com
Criminal Defense Attorney Tampa, Best Federal Defense Attorney St. Petersburg, Federal Criminal Defense Lawyer Tampa
The Rickman Law Firm is a Florida Law Firm dedicated to providing superior legal representation in the areas of Criminal Defense, DUI Defense and Personal Injury. If you are in need of legal representation contact Anthony Rickman today for a free consultation.

Semrush Rank: 693,774
Categories: Business, Business

Similar?
Yes 0 No 0

floridadefenders.com
The Smart Choice for Criminal & DUI Defense in Florida - Your Florida Defenders
With the multitude of laws set forth by the federal government, the state government, the counties and the cities, one poor judgment call or mistake can end up with you doing time in jail and having to pay steep fines. Our Law Firm We are tenacious criminal defense attorneys that are experienced in all areas […]

Semrush Rank: 918,256
Categories: Business, Business

Similar?
Yes 0 No 0

hillsboroughdefense.com
Tampa Criminal Defense Attorney | Metcalf Falls, Criminal Defense Attorneys, P.A.
Charged with a crime in Tampa? Get Answers and Protect Yourself. Call Criminal Defense Attorney Brett Metcalf. Free Consults Avail: (813) 258-4800.

Facebook ♡: 52
Categories: Business, Business

Similar?
Yes 0 No 0

tampaduiattorney.wordpress.com
Tampa DUI Attorney Blog
DUI Lawyers in Tampa, FL, at Sammis Law Firm, explain ways to fight charges for refusal or having a blood or breath alcohol concentration over .08.

Categories: Blogs/Wiki, Personal Websites and Blogs

Similar?
Yes 0 No 0

thetrafficstop.com
Attorneys for DUI and Traffic Offenses in South Florida
Attorneys at the Traffic Stop, with offices in West Palm Beach and Fort Lauderdale fight traffic tickets for speeding and moving violations, DUI, and driving offenses in Palm Beach County and Broward County, FL. Don't pay that ticket without a fight.

Categories: Business, Domain Parking

Similar?
Yes 0 No 0

tampacriminalattorneys.com
Tampa Criminal Defense & DUI Lawyers | Thomas & Paulk
Get a FREE case evaluation with Tampa criminal defense & DUI attorneys at Thomas & Paulk. Thousands of cases handled. Decades of experience. Available 24/7!

Moz DA: 26 Moz Rank: 3.3 Semrush Rank: 366,793
Categories: Business, Business

Similar?
Yes 0 No 0

ansaralaw.com
Fort Lauderdale Criminal Defense Lawyer | Broward County Criminal Defense Attorney | Richard Ansara
Free Consultation - Call (877) 277-3780 - Richard Ansara aggressively represents the accused against charges in Criminal & Criminal Defense cases.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

recklessdrivinglawyer.net
Virginia Reckless Driving Lawyer | Reckless Driving Defense in VA
If you have been charged with reckless driving, reach out to a Virginia reckless driving lawyer today to schedule your initial consultation today

Facebook ♡: 0
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

duinewsblog.org
DUI News Blog - DUI News and Laws
DUI News Blog is a collective effort by some of the best DUI defense attorneys from across the country to provide the public with current DUI news and laws.

Moz DA: 24 Moz Rank: 3.1 Semrush Rank: 3,062,726 Facebook ♡: 5
Categories: Blogs/Wiki, News and Media

Similar?
Yes 0 No 0

1800duilaws.com
DUI Laws & DWI Laws - 1800DUILaws
DUI Laws & DWI Laws - 1800DUILaws

Facebook ♡: 2
Categories: Education/Reference, Government and Legal Organizations

Similar?
Yes 0 No 0

duiattorneystampabay.com
IIS Windows Server

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

Suggest Site to this list (fightyourdui.com)

Please only suggest if the website is similar. We do check suggested websites carefully and only approve if it's completely similar.

Site Url

Why do you think it is similar?

Email address We'll never share your email with anyone else. You'll get a confirmation email.

3 (times) seven

I'm sure it's similar Yes

fightyourdui.com Reviews

No reviews have been made yet.

What is sitelike.org?

sitelike.org is a free tool to search and find Similar Websites, alternatives or related to the given site.
It helps you to find similar sites based on keyword overlap and shared audience.
Our team is manually checking and finding similar websites and also our visitors are helping us to find the best similar websites.
"Similar sites like" first finds the best and top keywords for all websites and rank them.
We also use our internal algorithm with analysing the website contents and also several web sources to determine the main topics of websites which are used to find similar websites that have the closest matching set of topics. Our ranking system uses user generated content created by our team, our visitors and also our algorithm.