Similar sites like markobryanlaw.com

Criminal Defense Attorney | Mark O’Bryan | Plano, Texas

Mark O’Bryan is an experienced criminal defense attorney who will aggressively defend you, fight the prosecution and law enforcement agencies pursuing you, and protect your legal rights. Call (972) 372-4054 today for a free consultation!

Categories: Marketing/Merchandising, Political Organizations
Topics: criminal defense attorney

Semrush Rank: 3,786,973

markobryanlaw.com Reviews

Sites similar to markobryanlaw.com - Top 76 markobryanlaw.com alternatives

texasdwisite.com
Dallas DWI Lawyers | Deandra Grant Law
Those accused of DWI or another crime in Texas can benefit from the legal experience of Dallas criminal defense attorney, Deandra Grant. Contact us today!

Semrush Rank: 1,092,459
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

Similar?
Yes 0 No 0

msperrylaw.com
Criminal Defense Attorney | Drug Crimes Lawyer Sarasota FL
At MSPerryLaw in Sarasota, our criminal defense attorneys and former prosecutors handle state and federal charges. Call 941-365-4000. We're available 24/7.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

totalduidefense.com
Criminal Defense Attorney | Criminal Defense Lawyer | Personal Injury Lawyer | Douglas, GA
George McCranie has gained fame for his success as a Georgia DUI Lawyer, Criminal Defense Attorney & Personal Injury Attorney. Speak with a qualified lawyer in Valdosta Ga.

Categories: Business

Similar?
Yes 0 No 0

aztriallawyer.com
Gilbert Traffic Ticket Attorney | DUI Defense Lawyer | Criminal Defense Attorney
The Gilbert Law Office of Karl A. Mueller, PLC, helps to reduce or drop criminal charges and traffic violation tickets throughout Arizona. Call for a Free Consultation at 602-697-8761.

Categories: Business, Reference

Similar?
Yes 0 No 0

doskocillaw.com
St. Louis & Fenton, MO Family Law & Criminal Defense Attorney | Doskocil Law Firm
Need an attorney for your family law or criminal defense case in the St. Louis area? Attorney Christopher J. Doskocil can help. Schedule a consultation.

Categories: Business, Business

Similar?
Yes 0 No 0

callyourlawyers.com
Chicago Immigration lawyer, Criminal defense attorney, Illinois DUI lawyer, Michael Baker 312-714-2800, 847-282-4723 Chicago, Northwest suburban law firm
Chicago law firm with practice in Immigration and Naturalization Law, Criminal Defense and DUI, Driving under the Influence of Alcohol, traffic and reinstatement. Law Offices of Michael Baker, attorney law firm services for Chicago, Northwest Suburbs, Rolling Meadows, Skokie, Buffalo Grove, Lake County, Green Card, Work visa, DUI defense

Categories: Education/Reference, Business

Similar?
Yes 0 No 0

gwinnettcriminallawyer.com
Criminal Defense Attorney | Family Law | Immigration | Bankruptcy
With more than 25 years of practice in Criminal Defense, Family & Immigration law, G. Cooper & Associates serve Norcross, Lawrenceville and Gwinnett County.

Categories: Marketing/Merchandising, Newly Observed Domain

Similar?
Yes 0 No 0

mikeventrella.com
Michael A. Ventrella, Esq., Criminal Defense Attorney
Michael A. Ventrella, Esq., Criminal Defense Attorney

Categories: Education/Reference, Government and Legal Organizations

Similar?
Yes 0 No 0

mcgrawlawfirm.com
St. Paul, MN Family Law & Criminal Defense Attorney | McGraw Law Firm, P.A.
Don't leave your family or your freedom up to chance. Allow our skilled attorney to help you seek the outcome you need after a divorce or criminal charge.

Facebook ♡: 0
Categories: Business, Business

Similar?
Yes 0 No 0

floridakeyslegal.com
Hutchison & Tubiana Law Firm | Criminal Defense Attorney - Florida Keys
David Hutchison & Vincent Tubiana are known for their experience in personal injury, criminal defense, estate planning, family law, appellate practice, consumer law & landlord/tenant matters.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

oklahomacriminallaw.com
Criminal Defense Lawyer, Tulsa, Oklahoma | Kevin Adams
Oklahoma criminal defense trial and appeal lawyer Kevin Adams handles felonies and misdemeanors in state and federal court. For a free Consultation 918 582-1313

Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

attorneymichaelfranklin.com
Worcester Divorce Attorney | Criminal Defense Attorney | Michael Franklin
Attorney Michael Franklin is a Worcester divorce attorney, family law attorney and criminal defense attorney. His practice is statewide with offices in Worcester, Massachusetts.

Facebook ♡: 0
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

notguiltyadams.com
DUI Lawyer & Criminal Defense Attorney
Our Cincinnati DUI lawyers and criminal defense attorneys represent clients facing charges of DUI, drug crimes, assault, theft, or other crimes in OH or KY.

Moz DA: 33 Moz Rank: 3.6 Semrush Rank: 87,202
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

mvdwi.com
Succession, Héritage - Le site d'information sur la transmission
Le site d'information sur la transmission

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

suffolkcountycriminallawyer.com
CRIMINAL DEFENSE ATTORNEY | Suffolk County Criminal Lawyer
FORMER PROSECUTORS. Our Suffolk County Criminal Lawyers have the experience you deserve. Our Criminal and DWI attorneys are available 24 hours. Call now. Consultation is Free.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

davealbo.com
Criminal Defense Attorney - Reckless Driving Lawyer - Fairfax VA - Dave Albo
Dave Albo is a former prosecutor, now leading Criminal Defense Attorneys in Fairfax VA. We will work to defend you and fight for your rights. Call us today.

Categories: Politics/Opinion, Web Hosting

Similar?
Yes 0 No 0

minneapoliscriminaldefenselaw.com
Bill Sherry, Criminal Defense Attorney | Sherry Law
Criminal Defense or Personal Injury questions? Contact attorney Bill Sherry for a free initial consultation. 25 years experience, serving all MN counties.

Categories: Business, Newly Observed Domain

Similar?
Yes 0 No 0

sullivanpllc.com
DUI Laywer | Criminal Defense Attorney | Personal Injury Everett, WA
Mr. Sullivan practice law in Everett, WA handling DUI, Criminal Defense, and Personal Injury related Washington matters, Washington. DUI Defense Lawyer, DWI Attorney, Auto Injury Lawyer, Personal Injury Lawyer, Wrongful Death.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

ronclement.com
Greenville Family Law, Personal Injury & Criminal Defense Attorney | Ronald S. Clement Attorney At Law
Ronald S. Clement Attorney At Law helps Greenville clients with cases of family law, personal injury, and criminal defense. Call now!

Categories: Business, Business

Similar?
Yes 0 No 0

fineganlaw.com
Colorado Personal Injury & Criminal Defense Attorney
James L. Finegan, P.C. offers personal injury and criminal defense attorney services in Colorado. Free consults at (303) 980-5511.

Categories: Business, Business

Similar?
Yes 0 No 0

notojail.com
Criminal Defense Attorney - Encino, Sherman Oaks, Van Nuys
Encino Criminal Defense Attorney - handles all Criminal Defense cases as if you were a family member (DUI, Drugs, etc).

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

harringtonmahoney.com
Criminal Defense Attorney | Buffalo, NY | Harrington & Mahoney
Harrington & Mahoney is The Leading Criminal Defense Law Firm Serving Buffalo, Rochester, and the Surrounding Areas. Call Us Today.

Categories: Government and Legal Organizations

Similar?
Yes 0 No 0

bassechicagolaw.com
Chicago DUI, criminal defense attorney | Nir Basse
Looking for a Chicago attorney with experience in Chicago DUI, criminal defense, liquor licensing, small business law and more? Call today: (312) 286-1186.

Categories: Business, Business

Similar?
Yes 0 No 0

rudoilaw.com
Criminal Defense Attorney | Rudoi Law | Royal Oak, MI
When you need a DUI and criminal defense lawyer, you need to trust the experts at Rudoi Law. Call us today at (248) 914-9387 to get started.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

austinlawyer.com
About Us - Houston Criminal Lawyer: The Charles Johnson Law Firm, Available 24/7
When you have been charged with a criminal offense, it is very important to understand your rights and defense options. An experienced Houston Criminal Lawyer can help you decide what steps you need to take next. I am an aggressive defense lawyer who will make every effort to fight the allegations against you. {5fd102f38cbc8eebcfca6fbb53a0def997bc2f58a9863ba1ab4fb4240465d96b}

Categories: Education/Reference, Meaningless Content

Similar?
Yes 0 No 0

grandrapidsdivorceattorneys.com
Grand Rapids Lawyers | Criminal Defense Attorney | Family Law Attorneys
Our Grand Rapids lawyers offer legal services for divorce, child custody, child support, criminal law, and more. Call us today at (616) 426-9576.

Categories: Newly Observed Domain

Similar?
Yes 0 No 0

lasvegascrimelawyer.com
Criminal Defense Lawyer Las Vegas | Criminal Defense Attorney
Facing criminal charges in Las Vegas ? Contact a Las Vegas criminal defense lawyer in order to get the experienced legal representation you deserve. Contact us at 702-420-2858.

Categories: Business, Political Organizations

Similar?
Yes 0 No 0

lawyersacramentoca.com
Criminal Defense Attorney | Comcast Sacramento | Cash Advance at Lawyersacramentoca.com
Find Criminal Defense Attorney, Comcast Sacramento and more at Lawyersacramentoca.com. Get the best of Lawyer Sacramento CA or The Lawyer, browse our section on Cash Advance or learn about Debt Consolidation. Lawyersacramentoca.com is the site for Criminal Defense Attorney.

Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

richedinger.com
Richard E. Edinger * Criminal Defense Attorney | DUI Attorney
Richard Edinger is an experienced, competent criminal defense attorney and DUI attorney in Fargo, North Dakota.

Categories: Information Technology

Similar?
Yes 0 No 0

hanford-lawyer.com
Arrested in Hanford or Kings County? | Law Offices of Sara D Bratsch - Criminal Defense Attorney
In the event that you or a loved one might be arrested in Hanford, California, or anywhere else in Kings County, California, you may need the following contact information. HANFORD LAW ENFORCEMENT Han

Categories: Business, Business,ADULT

Similar?
Yes 0 No 0

kellibynumlaw.com
Criminal Defense Attorney, Jacksonville, Divorce Attorney, DUI Lawyer
Experienced defense attorney. If you are arrested and need legal representation, our firm has the experience to provide zealous, competent legal advocacy and will ensure that your rights are protected and preserved.

Categories: Marketing/Merchandising, Advertising

Similar?
Yes 0 No 0

texaslawhawk.com
Fort Worth DWI Lawyer | Bryan E. Wilson, The Texas Law Hawk
Arrested for DWI in Texas? Let Bryan Wilson, the Texas Law Hawk fight for you! Contact us now to discuss your case with an experienced DWI attorney in Fort Worth.

Semrush Rank: 620,894
Categories: Business, Business

Similar?
Yes 0 No 0

austindwilawyer.net

Categories: Marketing/Merchandising, Shopping

Similar?
Yes 0 No 0

wilderdwidefense.com

Categories: Business, Business

Similar?
Yes 0 No 0

allentexascriminallaw.com
Allen Texas Criminal Law Blog - Published by Rosenthal & Wadas, PLLC
Published by Rosenthal & Wadas, PLLC

Categories: Blogs/Wiki, Government and Legal Organizations

Similar?
Yes 0 No 0

texasdefenseattorney.com
Dallas Criminal Defense Attorney | Law Offices of Frank Jackson
Call Frank Jackson in Dallas for experienced and aggressive criminal defense. Free consultations - call 214-306-6891.

Semrush Rank: 8,322,378
Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

dwitaskforce.org
DUI Lawyer Dallas - The DWI Attorney Task Force, Cost, Reviews
Find the Best DWI Lawyer in Dallas, Tx that wins cases. Drunk Driving Attorneys - Free Consultation. 4th DWI Texas, Probation, How much is a DUI lawyer? >>

Semrush Rank: 2,369,649
Categories: Business, Domain Parking

Similar?
Yes 0 No 0

lawcenterofaustin.com
Law Office of Kevin Dietz, PLLC
Law Office of Kevin Dietz, PLLC

Semrush Rank: 14,341,439
Categories: Internet Services, Business

Similar?
Yes 0 No 0

keithgore.com
McKinney TX Criminal Defense Lawyer | Federal Charges | Collin County
Keith Gore, Lawyer, is an accomplished criminal defense and family law attorney. For experience, skill and dedication, In McKinney, Texas, call 972-924-5665.

Semrush Rank: 2,861,109
Categories: Business, Business

Similar?
Yes 0 No 0

carlcederlaw.com
carlcederlaw.com
Just a moment...

Categories: Business, Government and Legal Organizations,???

Similar?
Yes 0 No 0

burlesonlawoffice.com
Plano Criminal Lawyer | Frisco DWI Attorney | Troy P. Burleson
Free Consultation - Call (469) 619-3800 - Troy P. Burleson aggressively represents the accused against charges in Criminal and DWI cases.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

robertguest.com
Guest and Gray Criminal Defense Lawyers | Forney, Rockwall, Dallas
Highest rated local criminal defense lawyers serving Dallas, Rockwall, Forney and Kaufman County. DWI, drug possession, assault, probation, felony and misdemeanor.

Categories: Sports, Government and Legal Organizations

Similar?
Yes 0 No 0

rosenthalwadas.com
Collin County Criminal Defense Attorneys | Free Consultation
Have been accused of a criminal offense? We're on your side. Contact our team of Collin County defense attorneys today.

Moz DA: 30 Moz Rank: 3.3
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

docsbailbonds.com
Dallas County Bail Bonds | Collin County TX Post Bail to Get Out of Jail | Denton County Bail Bondsman
Collin County bail bondsman to get out of prison in North Texas. Call us 24/7 at 214-747-4110. Serving Dallas, McKinney, Garland, Sherman, Bonham.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

deltabail.com
Dallas Bail Bonds | Delta Bail | Dallas And McKinney Texas Offices
Need Dallas Bail Bonds? Call Delta Bail Bonds 24 hours a day for bail in the Dallas and McKinney area. Get them out of jail quickly, call Delta (214)-526-4272.

Moz DA: 24 Moz Rank: 3.3 Semrush Rank: 1,433,149 Facebook ♡: 0
Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

brandmeirlaw.com
Attorney Bangor Maine – Lawyer Specializing in Criminal and Family Law
Attorney Bangor Maine - Lawyer Specializing in Criminal and Family Law

Categories: Business, Business

Similar?
Yes 0 No 0

pevetolaw.com
Best Plano Criminal Defense Lawyers - 2023 [UPDATE] Texas DWI &
Arrested for DWI or charged with another crime in Plano, TX? Criminal Lawyers can proudly defend your constitutional rights and uphold your reputation. If your goal is to avoid a criminal conviction, then contact a Plano criminal defense attorney. An experienced defense attorney will help you eliminate embarrassing criminal charges. Plano Criminal Attorney Near Me

Moz DA: 19 Moz Rank: 3.2 Semrush Rank: 787,519 Facebook ♡: 8
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

dwicollincounty.com
Plano DUI / DWI Attorney | Collin County Criminal Defense Lawyer
If you face criminal or drunk driving charges in Plano, Frisco or anywhere in Collin County, call a skilled criminal defense and DWI lawyer at Law Offices of Richard C. McConathy. We confidently fight DUI / DWI and criminal charges across North Texas.

Semrush Rank: 2,290,206
Categories: Business, Business

Similar?
Yes 0 No 0

roselawtx.wordpress.com
Log In — WordPress.com

Categories: Blogs/Wiki, Personal Websites and Blogs

Similar?
Yes 0 No 0

collincountyda.com
collincountyda.com
collincountyda.com

Categories: Government/Military, Government and Legal Organizations

Similar?
Yes 0 No 0

dallascriminalattorney.pro
Dallas Criminal Defense Attorney | Free Consultation | Roger E. Haynes
Roger E. Haynes - criminal defense attorney Dallas, TX. 22+ years experience. Free consultation. (214) 526-3300. Local and federal crimes representation.

Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

biedermanandburleson.com
Frisco Criminal Defense Attorneys | Collin County DWI Lawyers | Texas
Criminal, drug arrests and DWI defense attorneys in Collin County, Texas. Call 469-333-3333 for a free consult. Serving Frisco, McKinney, Plano and Denton.

Semrush Rank: 838,782
Categories: Business, Business

Similar?
Yes 0 No 0

jeffpiercelaw.com
Collin County Criminal Defense Attorney | Plano Sex Crime Lawyer | Frisco Juvenile Crimes Lawyer
Plano, TX. Serving Collin, Denton, and Dallas/Forth Worth; Former Criminal District Attorney; Former Police Officer; 972-423-0331; Including Assaults, DWI, Drugs, Sex Crimes, Juvenile

Semrush Rank: 4,094,262
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

thetexastrialattorney.com
Houston DWI Lawyer | DWI Attorney Harris County | Thiessen Law Firm
Charged with a DWI? You only have 15 days to save your license! Call our Houston DWI Lawyers at (713) 864-9000 for a free consultation now.

Semrush Rank: 139,983
Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

vdflaw.com
San Antonio Criminal Defense Lawyers | Family Law, Personal Injury
Vela & Del Fierro, PLLC, Attorneys at Law. Experienced San Antonio, Texas, attorneys handling criminal, personal injury and family law. Call [nap_phone id="LOCAL-REGULAR-NUMBER-2"].

Semrush Rank: 2,556,636
Categories: Business, Business

Similar?
Yes 0 No 0

planotrafficticketlawyer.com
Traffic Ticket Attorney in Plano | Speeding and Warrants Lawyer | Beltz Law Firm
Lawyers that defend tickets in Plano, Texas. Attorneys that can remove warrants for old tickets in Plano Municipal Court.

Moz DA: 12 Moz Rank: 2.5 Facebook ♡: 21
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

grandprairietrafficticketlawyer.com
Grand Prairie Traffic Ticket Lawyer | Warrants Lifted Attorney Texas |
Grand Prairie Traffic Ticket Lawyer | Warrants Lifted Attorney Texas |

Categories: Marketing/Merchandising, Newly Observed Domain

Similar?
Yes 0 No 0

watchdognation.com
Consumer Protection against Scams and Fraud | Watchdog Nation Blog
The blog that helps protect you and your family against scams and fraud by keeping you informed.

Categories: Marketing/Merchandising, Political Organizations

Similar?
Yes 0 No 0

tollfreehighways.com
Texans for Toll-free Highways - Texans working toward reforms through accountability and good public policy as well as promoting non-toll, affordable, and sensible transportation solutions.
Texans for Toll-free Highways - Texans working toward reforms through accountability and good public policy as well as promoting non-toll, affordable, and sensible transportation solutions.

Semrush Rank: 5,931,804
Categories: Non-Profit/Advocacy/NGO, Business

Similar?
Yes 0 No 0

saulinelaw.com
Panama City Criminal Defense
Arrested? Contact our Panama City criminal defense attorney at Albert J. Sauline, III Attorney at Law. With 10+ years of legal experience and free phone consults, we can help you!

Categories: Business, Business

Similar?
Yes 0 No 0

collincountydwiattorneys.com
Collin County DWI Lawyer | Frisco, Texas Drunk Driving Defense Attorney | The Law Offices of Biederman & Burleson, P.L.L.C.
Free Consultation - Call (866) 439-2182 - The Law Offices of Biederman & Burleson, P.L.L.C. aggressively represents the accused against charges in DWI & Drunk Driving Defense cases.

Categories: Business, Business

Similar?
Yes 0 No 0

beltzlaw.com
Beltz Law Firm | Dallas Traffic Ticket, Accident & Criminal Attorney
Beltz Law Firm is a top rated Dallas Law Firm. We provide legal services for injury cases, traffic tickets, criminal defense, and DUI as well as DWI.

Moz DA: 22 Moz Rank: 3.7 Semrush Rank: 637,049
Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

jackbynoattorney.com
Dallas-Fort Worth Traffic Ticket Attorney | Traffic Court, DWI, License Suspension
Have you been cited for a traffic violation in the Dallas-Fort Worth area? Call an attorney at Jack Byno & Associates at 817-685-0912. Representing DFW clients everywhere, including Arlington, Frisco, Irving, Denton, Mesquite and Allen, TX.

Facebook ♡: 0
Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

thehoustondwilawyer.com
thehoustondwilawyer.com
Charged with DWI/DUI, you need an attorney, who's law practice is solely DWI Defense. It’s all we do. These are complex & involve issues of law and science

Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

kencrainattorney.com
Ken Crain, Attorney at Law--When Experience Matters
Ken Crain, Attorney. High quality, ethical, and personalized legal representation by an experienced attorney at a reasonable cost. When you hire Ken Crain to handle your legal needs you will get an attorney with over 33 years of experience who will listen to you and who will be there for you when you need his help.

Semrush Rank: 5,679,575
Categories: Marketing/Merchandising, Shopping

Similar?
Yes 0 No 0

westfallsellers.com
Fort Worth Federal Criminal Defense Lawyer | Westfall Sellers Attorneys
Get out from under the weight of criminal charges, get back to life. Call the proven Fort Worth criminal attorneys at Westfall Sellers today: 817-928-4222

Semrush Rank: 788,936
Categories: Business, Business

Similar?
Yes 0 No 0

paulkeylaw.com
Home | Paul Key Law
Call (972) 562-4446 – Paul Key aggressively represents the accused against charges in Criminal & Criminal Defense cases. Contact us today!

Semrush Rank: 2,655,803
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

andrewdeeganlaw.com
Fort Worth Criminal Lawyer - Criminal Defense Attorney | Andrew Deegan Attorney at Law
Fort Worth Criminal Lawyer - Criminal Defense Attorney | Andrew Deegan Attorney at Law

Semrush Rank: 548,166
Categories: Business, Business

Similar?
Yes 0 No 0

billknoxattorney.com

Moz DA: 17 Moz Rank: 2.4 Semrush Rank: 1,166,178 Facebook ♡: 530
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

galvestonjustice.com
Zendeh Del & Associates, PLLC
If you’ve been arrested, pulled over, or are facing a bankruptcy, immigration, or personal injury matter, trust the Galveston lawyers at Zendeh Del & Associates, PLLC. Schedule your free consultation today!

Facebook ♡: 26
Categories: Business, Political Organizations

Similar?
Yes 0 No 0

georgetowncriminaldefenselawyer.com
Homepage (Law Office) - Georgetown Criminal Defense Lawyer
WORKING WITH ME I want to give you an idea of what it’s like to work with me. I'm ready to start talking about the strengths and weaknesses of your case, I'm always on time and very detail oriented. I’m here to help you, and I’ll guide you through any kind of problem you need help with ...

Facebook ♡: 0
Categories: Business, Business

Similar?
Yes 0 No 0

jmichaelprice.com
Dallas Criminal Defense Attorney | Plano Criminal Lawyer
Dallas criminal defense lawyer J. Michael Price II provides experienced and aggressive representation in Plano, Dallas and throughout Collin County. 214-765-8000, Call today.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

dougmurphylaw.com
Houston DWI and Criminal Defense Lawyer | Attorney Doug Murphy
If you're facing DWI charges, our Houston DWI lawyer Doug Murphy will fight tirelessly for your freedom and protect your future. Call (713) 229-8333.

Semrush Rank: 83,109
Categories: Business, Business

Similar?
Yes 0 No 0

houstoncriminallaw.com
Texas Criminal Defense Attorney | Criminal Lawyer Houston | Chernoff Law
Contact Texas Criminal Defense Attorney Ed Chernoff Today at 713-909-7827. Get a Free Consultation With an Experienced Criminal Lawyer in Houston, TX at Chernoff Law.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

conroecriminaldefenselawyer.com
Texas Criminal Appeals Blog — Published by Texas Criminal Appellate Attorneys — Pullan & Young
Texas Criminal Appeals Blog — Published by Texas Criminal Appellate Attorneys — Pullan & Young

Categories: Blogs/Wiki, Information Technology

Similar?
Yes 0 No 0

Suggest Site to this list (markobryanlaw.com)

Please only suggest if the website is similar. We do check suggested websites carefully and only approve if it's completely similar.

Site Url

Why do you think it is similar?

Email address We'll never share your email with anyone else. You'll get a confirmation email.

3 (times) seven

I'm sure it's similar Yes

markobryanlaw.com Reviews

No reviews have been made yet.

What is sitelike.org?

sitelike.org is a free tool to search and find Similar Websites, alternatives or related to the given site.
It helps you to find similar sites based on keyword overlap and shared audience.
Our team is manually checking and finding similar websites and also our visitors are helping us to find the best similar websites.
"Similar sites like" first finds the best and top keywords for all websites and rank them.
We also use our internal algorithm with analysing the website contents and also several web sources to determine the main topics of websites which are used to find similar websites that have the closest matching set of topics. Our ranking system uses user generated content created by our team, our visitors and also our algorithm.