Similar sites like passipatel.com

Brampton Criminal Lawyers | Trusted & Unbiased - Passi & Patel

Passi & Patel are experienced criminal lawyers in Brampton, ON who know how to get charges dropped or dismissed. Never plead guilty, get a FREE consultation today.

Categories: Business, Business
Topics: brampton criminal lawyers

Facebook ♡: 6

passipatel.com Reviews

Sites similar to passipatel.com - Top 74 passipatel.com alternatives

michellejohal.ca
Michelle Johal - Criminal Lawyer in Brampton
Michelle Johal is an experienced Criminal Lawyer in Brampton who can assist you in navigating through all the stages of criminal proceeding. Call (416) 824-3584

Semrush Rank: 4,738,692
Categories: Business, Business

Similar?
Yes 0 No 0

mitchengellaw.ca
Criminal Defence Lawyer Brampton | Mitch Engel
Mitch Engel is one of the most respected & sought-after criminal defence lawyer in Brampton. If you’ve been charged with a crime, Call us now : (866) 761-7077

Semrush Rank: 16,446,171
Categories: Business, Business

Similar?
Yes 0 No 0

edgarlaw.ca
Criminal Defence Lawyer in Brampton | Andrew Edgar Law
Brampton Criminal Lawyer Andrew Edgar is one of Ontario's top criminal defence lawyers. Bail, drug crimes, assault, theft, DUI and more. Visit our website.

Semrush Rank: 6,607,972
Categories: Business, Other Adult Materials

Similar?
Yes 0 No 0

bartlettlaw.ca
Criminal Lawyer - Criminal Defence Lawyer Brampton & Mississauga | Michael Bartlett Criminal Trials & Appeals
Criminal Lawyer - Criminal Defence Lawyer Brampton & Mississauga | Michael Bartlett Criminal Trials & Appeals

Semrush Rank: 6,595,913
Categories: Business, Business

Similar?
Yes 0 No 0

baratzlaw.com
Welcome To Baratz Law
Lawyers at Baratz law represent individuals in family, criminal and personal injury matters. Call today for a free consultation.

Semrush Rank: 8,942,368
Categories: Business, Business

Similar?
Yes 0 No 0

gurbirsinghlaw.ca
Captcha

Semrush Rank: 8,371,709
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

virkbarristers.ca
Criminal Lawyer Mississauga | Virk Barristers
Suny Virk Of Virk Barristers is a criminal lawyer in Mississauga. With Over 20+ Years In Criminal Law, Suny Virk Is The Mississauga Criminal Lawyer. Criminal Lawyer Mississauga Suny Virk

Semrush Rank: 56,394,784
Categories: Business, Business

Similar?
Yes 0 No 0

brianrosslaw.com
Criminal Lawyer Toronto & Defence Law Firm - Brian Ross
Brian Ross is an experienced Toronto criminal defence lawyer who focuses on results & will fight for you from beginning to end. Get a free consultation today

Categories: Business, Business

Similar?
Yes 0 No 0

edmondbrown.com
Brampton Criminal Lawyer - Edmond Brown Law Firm
Edmond Brown is a criminal lawyer in Brampton with over 40 years of experience. Contact us today for a free consultation with our law firm!

Semrush Rank: 4,001,629
Categories: Business, Business

Similar?
Yes 0 No 0

baidwanlawyers.com
Best lawyers in Brampton, Toronto for family law, criminal law, civil law
Legal advise company in Brampton and Mississauga focused on providing support on areas of Criminal Law, Family Law or Real Estate Law. - Call 905-230-8888

Semrush Rank: 3,603,618
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

saggilawfirm.com
Brampton Criminal Lawyer - Saggi Law Firm
Mandeep Saggi (Principal Lawyer) Brampton Criminal Lawyer is a local Brampton Criminal Lawyer. Mandeep makes daily appearances at the Brampton Courthouse.

Semrush Rank: 1,390,995 Facebook ♡: 33
Categories: Business, Business

Similar?
Yes 0 No 0

manncriminallaw.ca
Lawyer Brampton | Law Firm | LAW OFFICE OF RANBIR S Mann
If you’re searching for a proficient lawyer who can provide unparalleled legal services, turn to LAW OFFICE OF RANBIR S Mann, a choice law firm in Brampton, ON.

Semrush Rank: 33,501,506
Categories: Business, Business

Similar?
Yes 0 No 0

jagvirklawyers.com
Criminal Lawyers | Toronto | GTA | Ontario | Jag Virk Law
Toronto criminal lawyers. Special focus on assault & s*xual assault charges, DUI & drug charges, weapon charges, bail, and negotiating with the Crown Attorney. Call us at 1-888-JAG-VIRK

Semrush Rank: 5,015,048
Categories: Business, ???

Similar?
Yes 0 No 0

manbirsodhilaw.com
Criminal Defence Lawyer Brampton
Manbir Sodhi is a Brampton criminal lawyer who provides highest-quality legal representation at every stage of the criminal law process. Call (905) 457-2546

Semrush Rank: 12,759,391
Categories: Business, Business

Similar?
Yes 0 No 0

dhindsalaw.ca
Brampton Criminal Lawyer | Dhindsa Law | Affordable Lawyer
Criminal lawyer Brampton Dhindsa Law provides top criminal defense lawyer services for assault, domestic assault, drug charges, DUI & more

Semrush Rank: 13,170,196
Categories: Business, Business

Similar?
Yes 0 No 0

whatthelaw.com
Criminal Lawyers Richmond Hill & GTA | What The Law
WhatTheLaw is a leading criminal defence law firm in Ontario founded by Mustafa Sheikh. We Handle all Criminal Charges across all Courthouses in Ontario.

Semrush Rank: 3,737,662
Categories: Business, Business

Similar?
Yes 0 No 0

lawyerplug.com
Richmond Hill Affordable Criminal Lawyer Plug Free Legal Advice Call 24/7
Arrested for Domestic Assault, Drugs, DUI, Sexual Assault Or Need A Bail Lawyer? Free Criminal Lawyer Advice Anytime Call Us (647)490-7660 For Help

Semrush Rank: 6,984,096
Categories: Business, ???

Similar?
Yes 0 No 0

batishlaw.com
Top Criminal Lawyer and Family Lawyer in Brampton and Mississauga, CA
At Batish Law Firm, we take pride in being the best Criminal Defense and Family Lawyers in Brampton and Mississauga, Canada. Looking for a Punjabi Criminal Lawyer in Toronto? Reach us today.

Semrush Rank: 9,137,777 Facebook ♡: 101
Categories: Business, Business

Similar?
Yes 0 No 0

lcp-law.com
Criminal Lawyer – Lockyer Campbell Posner – 1-844-395-4084
Charged with a crime? Confidential consultation 24 hours/day: Lockyer Campbell Posner Toll-free: 1-844-395-4084. Get the representation you need.

Semrush Rank: 2,851,406
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

peellawoffice.com
R & S Law office Brampton- Family Lawyer - Criminal Defence Lawyer
R & S Lawyers providing legal services in the area of Family law, Criminal law, Immigration, & Business law in Brampton & surrounding cities.

Semrush Rank: 11,707,715
Categories: Business, Business

Similar?
Yes 0 No 0

saini-law.com
Criminal Lawyer in Brampton, On|Saini Law
Saini Law is an experienced Criminal lawyer in Brampton who provides a wide range of legal services in criminal law, immigration law and DUI law. Call us today on 647-823-6767

Semrush Rank: 3,565,848
Categories: Business, Business

Similar?
Yes 0 No 0

masstsang.com
Criminal Lawyers Toronto. Criminal Defence Lawyer | MASS TSANG Law Firm
Toronto criminal lawyers, Mass Tsang successfully defend against criminal charges in s*xual assault, DUI, drug possession, domestic violence, theft & fraud cases.

Semrush Rank: 3,115,307
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

Similar?
Yes 0 No 0

daleybyers.com
Criminal Lawyer's Toronto | Daleybyers : Toronto Defense Lawyers
Experienced Criminal Lawyers in Toronto. Free Consultation, Available 24/7. 32 Years of Experience. #1 Law firm in Toronto, Ontario

Moz DA: 21 Moz Rank: 2.9 Semrush Rank: 6,817,641
Categories: Government and Legal Organizations

Similar?
Yes 0 No 0

crimlawcanada.com
Criminal Lawyers Toronto | Criminal Law Firm | Bytensky Shikhman
Leading Criminal Defence Lawyers Toronto - Bytensky Shikhman. Criminal Law Firm has extensive experience in criminal law, serving in all parts of the GTA.

Semrush Rank: 2,355,007 Facebook ♡: 134
Categories: Society/Law, Science/Social Sciences, Recreation/Autos, Business, Government and Legal Organizations

Similar?
Yes 0 No 0

farjoudlaw.com
Toronto Criminal Defence Lawyer | Farjoud Law
Facing criminal charges? Contact Farjoud Law to speak directly to a criminal lawyer available 24 hours/day: Call 647-606-6776 for defence you deserve

Facebook ♡: 18
Categories: Business, Business

Similar?
Yes 0 No 0

everstonelaw.ca
Criminal Lawyer in Mississauga, Brampton & Milton, ON
Criminal Defence & Real Estate Lawyer at Everstone Law Professional Corporation offers legal consultations to clients across Mississauga, Brampton, Oakville, Milton.

Categories: Business, Business

Similar?
Yes 0 No 0

scardicchiolaw.com
Criminal Lawyers & Personal Injury | Mississauga Brampton Milton
Criminal Lawyers in Mississauga, Personal Injury, Civil Lawyers, in Mississauga, Brampton, Milton, Toronto, Newmarket, Vaughan, York region, Bradford, Hamilton, Orangeville, Oshawa, Barrie, Oakville, Burlington

Semrush Rank: 6,482,085
Categories: Business, Business

Similar?
Yes 0 No 0

kruselaw.ca
Kruse Law Firm - Ontario Criminal & DUI Lawyers
This is heading two, the second header This is an example page. It’s different from a blog post because it will stay in one place and will show up in your site navigation (in most themes). Most people start with an About page that introduces them to potential site visitors. It might say something like […]

Semrush Rank: 1,422,638
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

lawintoronto.com
Toronto Criminal Lawyer - The Robb MacDonald Defence Firm
Experienced Toronto Criminal Defence Lawyer - Robb MacDonald, one of Toronto's preeminent criminal defence lawyers. - Call (416)315-1505 today!

Semrush Rank: 5,217,728
Categories: Business, Business

Similar?
Yes 0 No 0

peellawchambers.com
Best Criminal Defense Lawyer in Brampton - Peel Law Chambers
Looking for the best criminal defense lawyer in Brampton? Call Gary Batasar at 905-866-6464 for all criminal cases including, assault, murder, theft & more.

Semrush Rank: 29,089,917
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

defencegroup.ca
Criminal Defence Lawyer Toronto | The Defence Group
Looking for a defence lawyer in Toronto? The Defence Group is a leading criminal defence law firm specializing in criminal law, assault law & more. Call us!

Semrush Rank: 2,070,548
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

vakililaw.com
Vakili Law Group - A Greater Toronto Boutique Law Firm
Vakili Law Group is a law firm with focused on Criminal Law, Real Estate Law, Business Law and Wills & Estates.

Moz DA: 12 Moz Rank: 2.8 Semrush Rank: 9,834,012 Facebook ♡: 1
Categories: Business, Political Organizations

Similar?
Yes 0 No 0

gsplaw.ca
Best Criminal Lawyer | GSP Law | Toronto, Brampton, Orangeville
GSP Law specializes in offering clients the best representation possible in criminal matters. Discover Criminal Lawyer in GTA. Learn More.

Semrush Rank: 24,417,305
Categories: Business, Business

Similar?
Yes 0 No 0

currielaw.ca
Currie Law | Criminal Lawyer Oakville, Criminal Defence Attorney, Legal Help Halton
Criminal defence lawyer Maureen Currie has over 30 years of experience in criminal law. Her criminal law office is in Oakville where she provides the security and strength of representation of experienced counsel. Maureen can help with Assault, Sexual Assault, Robbery, Harassment Charges and more.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

ontario-criminal-lawyers.com
Criminal Lawyers Toronto | Charitsis Law | Criminal Defence
Toronto criminal lawyers for impaired driving, DUI, domestic assault, s*xual assault, headed by Toronto Criminal Lawyer Nicholas Charitsis

Categories: Business, Political Organizations

Similar?
Yes 0 No 0

toplawyerscanada.ca
Top Lawyers ™ | Leading Canadian Lawyers
Top Lawyers is an exclusive Canadian lawyer directory featuring leading lawyers in Canada. Find experienced lawyers near you and work toward the best results.

Moz DA: 19 Moz Rank: 2.9 Semrush Rank: 2,836,295 Facebook ♡: 40
Categories: Society/Law, Computers/Internet, Business/Resources, Business, Government and Legal Organizations

Similar?
Yes 0 No 0

bernsteinlawgroup.ca
Criminal & Personal Injury Lawyers | Bernstein Law Group Hamilton, ON
Call 905-546-1990 if you have been charged with a crime in Hamilton or if you have legal concerns related to mental-health, consent or capacity.

Semrush Rank: 2,956,231
Categories: Business, Information Technology

Similar?
Yes 0 No 0

mccullighlawyer.ca
Criminal Lawyer Services in Brampton
W. John McCulligh Professional Corporation Barrister & Solicitor represents clients in need of a criminal lawyer in Brampton. Call us today to find out more! Experienced Attorney. Protect Your Rights.

Semrush Rank: 15,745,604
Categories: Business, Information Technology

Similar?
Yes 0 No 0

weisberg.ca
Toronto Criminal Lawyer | Criminal Law Firm | Weisberg Law
Weisberg Law has successfully handled criminal allegations of homicide, assault, fraud, drug offences and more. Contact us for a consultation today:

Semrush Rank: 683,736
Categories: Business, Political Organizations

Similar?
Yes 0 No 0

neillaw.ca
Criminal lawyer Oakville Burlington Milton Georgetown Mississauga Brampton Toronto Hamilton Kitchener Cambridge Ontario
Brendan Neil Criminal Lawyer, Certified Specialist in Criminal Law lawyer offering legal representation for all criminal law offences in Central West Ontario.

Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

mooncriminallaw.ca
Moon Rozier LPC | Criminal Trials and Appeals
Criminal defense lawyers who have successfully litigated a host of high profile criminal & constitutional trials throughout Brampton & Ontario. We push back.

Semrush Rank: 8,438,276
Categories: Business, Business

Similar?
Yes 0 No 0

mattislaw.ca
Law Firms in Toronto | Lawyer Office Brampton | Mattis Law Professional Corporation
Are you looking for top law firms in Toronto, contact Mattis Law Professional Corporation today - trusted and experienced lawyer office Brampton. ☎️: 647-348-6588, 905-230-8898

Semrush Rank: 5,175,408
Categories: Business, Business

Similar?
Yes 0 No 0

jeffreismanlaw.ca
Criminal Defence Lawyer Toronto, ON | Jeffrey I. Reisman
Jeffrey Reisman is an experienced Toronto criminal defence lawyer defending against criminal charges like impaired driving, assault, probation violation & more.

Semrush Rank: 4,054,618
Categories: Business, Business

Similar?
Yes 0 No 0

dnlawfirm.ca
Dnlawfirm – Deol & Nagpal
Dnlawfirm - Deol & Nagpal

Semrush Rank: 5,206,721
Categories: Business, Business

Similar?
Yes 0 No 0

affordabledefence.com
Ottawa Criminal Defence Lawyers | Affordable Defence
Affordable Defence is a renowned criminal law firm in Ottawa that believes quality representation doesn't need to be a privilege reserved for the wealthy.

Semrush Rank: 3,380,309
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

shaffielaw.ca
Toronto Criminal Lawyer | Domestic Violence, Sexual Assault, DUI | Shaffie Law
Toronto criminal lawyer exclusively defending domestic violence, s*xual assault, and drinking and driving charges across Ontario. Trust an experienced criminal lawyer to get you the best result in your Ontario criminal case.

Semrush Rank: 5,179,838
Categories: Business, Business

Similar?
Yes 0 No 0

legalaccess.ca
Criminal Lawyers | Personal Injury Lawyers | Family Lawyer | Legal Access
Legal Access is your number one source for Criminal lawyers, personal injury lawyers, Family Lawyers and much more. Free Consultation 1-888-402-9555.

Semrush Rank: 8,757,636
Categories: Business, Business

Similar?
Yes 0 No 0

pdclawyers.ca
Prouse, Dash & Crouch | PDC
Strategic legal thinking. Our aim is to find the right solution for you, quickly and cost effectively. Based in the heart of downtown Brampton since 1948.

Semrush Rank: 2,752,521
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

kahlonlaw.com
Criminal Lawyer Mississauga | Kahlon Law
Looking for a Criminal Lawyer Mississauga? We have a proven track record for all types of criminal charges. Speak to a lawyer now.

Moz DA: 19 Moz Rank: 3.5 Semrush Rank: 40,161,414 Facebook ♡: 5
Categories: Business, Business

Similar?
Yes 0 No 0

henderson-raybonlaw.com
Criminal Defense Attorney | Personal Injury Legal Claims | Milton, FL
If you need exceptional criminal defense or personal injury advocacy in Florida, turn to Henderson & Raybon, PLLC. Call our Milton office at 850-462-4521.

Semrush Rank: 2,316,291
Categories: Business, Business

Similar?
Yes 0 No 0

boatingview.com
boatingview.com Is for Sale
The premium domain name boatingview.com is available for sale!

Categories: Blogs/Wiki, ,Business

Similar?
Yes 0 No 0

anthonydemarco.ca
Toronto Criminal Defence Lawyer | Anthony De Marco
Charged with a crime? Toronto offence lawyer Anthony De Marco offers a free consultation. Call 416-651-2299 today.

Semrush Rank: 3,237,613
Categories: Business, Business

Similar?
Yes 0 No 0

crim-lawyers.ca
Toronto Criminal Lawyer Morrie Luft: Committed to Your Defence
Toronto criminal lawyer Morrie Luft has a proven track record defending drug and assault charges, DUI, peace bonds, shoplifting, theft and s*xual assault.

Categories: Business, Political Organizations

Similar?
Yes 0 No 0

drivinglaw.com.au
Driving Law Traffic Lawyer Queensland - Driving Law
The DUI, Work licence, Disqualified Driving and Hardship Licence Queensland supersite.

Moz DA: 22 Moz Rank: 3.1 Semrush Rank: 32,614,763 Facebook ♡: 9
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

cflaw.ca
Criminal Lawyers Toronto | Toronto Criminal Law Firm
Toronto Criminal Lawyers in Ontario Canada Experienced in Murder, Fraud, DUI, Professional Regulatory, Drug, Sexual Assault, Bail, Theft, Tax Prosecutions and More

Moz DA: 26 Moz Rank: 3.9 Semrush Rank: 2,330,048
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

gardewilson.com.au
Criminal Lawyers Melbourne | Criminal Defence Lawyer | Garde Wilson Lawyers
Leading Melbourne criminal lawyers. Zarah Garde-Wilson is built a reputation for providing expert criminal defence in all criminal law matters ranging from drink driving through to murder.

Semrush Rank: 3,028,850
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

mehdiau.com

Semrush Rank: 2,085,007 Facebook ♡: 71
Categories: Business, Business

Similar?
Yes 0 No 0

mpjlaw.ca
Toronto Criminal Lawyer | Michael P. Juskey, B.A., LL.B. | 416-428-2760
Looking for a Toronto Criminal Lawyer? Michael has successfully defended hundreds of criminal charges and will fight for the best possible result.

Semrush Rank: 4,754,702
Categories: Business, Political Organizations

Similar?
Yes 0 No 0

emkeylaw.com
Reading Criminal Defense Lawyer | Emkey Law Firm
Arrested? Got a DUI? Emkey Law Firm can combat your charges. Contact our Reading criminal defense attorney 24/7 to schedule your complimentary consultation!

Categories: Business, Business

Similar?
Yes 0 No 0

winnipegcriminaldefencelawyer.ca
Joshua Rogala | Winnipeg Criminal Defence Lawyer
Joshua Rogala is a leading Winnipeg Criminal Defence Lawyer. He is experienced in defending domestic assaults, impaired driving, thefts, and more.

Semrush Rank: 4,647,308
Categories: Internet Services, Business

Similar?
Yes 0 No 0

derushalawfirm.com
Family Law Lawyer | DeRusha Law Firm | Mississauga
Lawyers at DeRusha Law Firm practicing in Family Law, Wills & Estates, Business/Corporate Law, and Civil Litigation. FREE, consultation 905-625-2874.

Semrush Rank: 15,572,617
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

adeptfamilylawyers.com
Adept Family Lawyers, Calgary, Alberta
Personalized Counsel - Skilfully Delivered. Adept Family Lawyers is an exclusive family law practice, based in Calgary, AB, Canada.

Categories: Business, Business

Similar?
Yes 0 No 0

remedial.net
Back On Track - Ontario's Impaired Driving Remedial Measures Program
For offences that take place on or after September 30, 1998, the Highway Traffic Act requires convicted impaired drivers or drivers with 2 or more roadside suspensions to successfully complete Back on Track, Ontario's Remedial Measures Program, before their licences can be reinstated. Participants must pay a fee of $634 for convicted impaired drivers or $294 for roadside suspensions to cover the costs of the program.
If you are convicted of an impaired offence, you will receive a suspension notice from the Ministry of Transportation of Ontario (MTO). The notice includes your remedial requirement and the length of your licence suspension.
You should register for Back on Track a week (7 days) after your impaired conviction or roadside suspensions. It may take up to 11 months to complete all parts of the Back on Track program. Assessment, 1 or 2 day workshop and 6 month follow-up.
Please note: If you do not complete all components of the Back on Track program within your suspension period, your licence will be further suspended.

Semrush Rank: 2,793,440
Categories: Education/Reference, Health and Wellness

Similar?
Yes 0 No 0

Similar?
Yes 0 No 0

oykhmancriminaldefence.com
Calgary Criminal Lawyers | Calgary's #1 Google-Reviewed Criminal Firm | Strategic Criminal Defence Lawyers Calgary
If you have been charged with a criminal offence in Calgary, contact our experienced and dedicated legal team. We will fight for your rights!

Semrush Rank: 785,401
Categories: Business, Business

Similar?
Yes 0 No 0

divorcego.ca
Divorce Lawyer Toronto - Family Lawyer Toronto | Divorcego.ca
Hire the Best Divorce Lawyer Toronto at Divorcego.ca. We are experienced Toronto Family Lawyers offering affordable ways to separate smart.

Semrush Rank: 1,940,327 Facebook ♡: 135
Categories: Business, Business

Similar?
Yes 0 No 0

tsclaw.ca
HOME - TSC Law - Mississauga & Brampton Real Estate, Commercial, Civil Litigation and Corporate Lawyers
Brampton & Mississauga's Corporate, Commercial, Real Estate and Civil Litigation: Our real world experience, our commitment to excellence and our appreciation for your realities allows us to work with you to grow and protect your assets, solve problems and overcome your challenges in a quick and cost-effective manner. Call us now at 905-796-7526.

Semrush Rank: 4,347,780
Categories: Business, Business

Similar?
Yes 0 No 0

starylaw.com
Leading Criminal Lawyers Melbourne | Stary Norton Halphen
A leading criminal law firm in Melbourne, Stary Norton Halphen provides specialist, professional legal advice for all criminal law matters. Call (03) 8622 8200 today.

Semrush Rank: 2,466,597
Categories: Business, Business

Similar?
Yes 0 No 0

hicksadams.ca
Toronto Criminal Lawyers fighting criminal charges at Trial & Appeal
Experienced criminal lawyers ready to defend your rights in Toronto or anywhere in Ontario. Call us at 416-975-1700 or contact us online for a free consultation.

Categories: Business, Business

Similar?
Yes 0 No 0

mydefence.ca
Donich Law | Toronto Criminal Lawyers
DONICH LAW - Toronto Lawyers delivering the best possible service in Criminal Defence, Professional Regulation and Civil Litigation across Ontario.

Semrush Rank: 1,013,578
Categories: Business, Personal Websites and Blogs

Similar?
Yes 0 No 0

minhaslawyers.ca
Law Firm in Mississauga, Brampton - Minhas Lawyers
Minhas Lawyers is a leading law firm serving across Mississauga & Brampton. We have expertise in all types of legal issues, including Family Law, Real Estate Law, Immigration Law, Business Law & more.

Semrush Rank: 5,717,012
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

stephenjackcriminallawyer.ca
Criminal Lawyer in Toronto | Stephen Jack
Stephen Jack is a criminal defence lawyer in Toronto and the surrounding area. Stephen represents individuals charged with criminal offences and motor vehicle offences

Semrush Rank: 2,832,857
Categories: Business, Personal Websites and Blogs

Similar?
Yes 0 No 0

ericksonlaw.ca
Criminal & Sexual Assault Defence Lawyer in Toronto Area 24/7
If you have been arrested call (416) 363-3612 to speak with Toronto sexual assault defence lawyer John Erickson. Immediate Help Available.

Semrush Rank: 3,346,386
Categories: Business, Business

Similar?
Yes 0 No 0

Suggest Site to this list (passipatel.com)

Please only suggest if the website is similar. We do check suggested websites carefully and only approve if it's completely similar.

Site Url

Why do you think it is similar?

Email address We'll never share your email with anyone else. You'll get a confirmation email.

3 (times) seven

I'm sure it's similar Yes

passipatel.com Reviews

No reviews have been made yet.

What is sitelike.org?

sitelike.org is a free tool to search and find Similar Websites, alternatives or related to the given site.
It helps you to find similar sites based on keyword overlap and shared audience.
Our team is manually checking and finding similar websites and also our visitors are helping us to find the best similar websites.
"Similar sites like" first finds the best and top keywords for all websites and rank them.
We also use our internal algorithm with analysing the website contents and also several web sources to determine the main topics of websites which are used to find similar websites that have the closest matching set of topics. Our ranking system uses user generated content created by our team, our visitors and also our algorithm.