Similar sites like wechsler-law.com

Orlando Divorce Lawyer | Winter Park Family Law Attorney | Child Support & Alimony Lawyer Florida

Mercedes R. Wechsler, P.A. is a full service family law firm located in Orlando, Florida that is here to help families with all of their divorce, probate and product liability needs. To schedule an appointment, please call 407-839-1364.

Categories: Business, Government and Legal Organizations
Topics: alimony lawyer florida, child support &, orlando divorce lawyer, winter park family law attorney

Semrush Rank: 3,455,910

wechsler-law.com Reviews

Sites similar to wechsler-law.com - Top 67 wechsler-law.com alternatives

myphlaw.com
Orlando Divorce Attorneys | The Law Office of Paulette Hamilton, P.A.
When facing a tough family matter, you deserve a firm that puts your family first. Call our Orlando divorce attorney now to schedule an initial consultation.

Semrush Rank: 5,481,233
Categories: Business, Information Technology

Similar?
Yes 0 No 0

lawyerallen.com
Diaz Family Law Firm | Mount Dora Divorce Attorney | Custody Lawyer
In the Orlando metro, call the experienced attorneys at Diaz Family Law Firm to resolve your divorce or family law case at 352-400-4820. Se habla Español.

Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

divorcelawyerinmichigan.com
Law Offices of Jennifer S. Peterson-Ramsey | Michigan Family Law, Divorce & Divorce Mediation, Child Support & Child Custody, criminal Law Attorney | Law Offices of Jennifer S. Peterson-Ramsey
Westland litigator Jennifer S. Peterson-Ramsey has more than 18 years' experience representing individuals and families in Michigan. Call at 248-449-4091

Semrush Rank: 11,447,153
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

orlandodivorcehelp.com
Orlando Divorce Lawyer | Florida Family Law | The Kramer Law Firm
Ask an Orlando divorce lawyer at the Kramer Law Firm for help with divorce, divorce mediation, modification orders, Orlando custody actions, and family law matters.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

weertslaw.com
Fargo Family Law | Child Support & Custody Lawyer Cass County
At Melinda Weerts Law, PLLC, our family law attorneys are committed to finding positive results for you. Schedule a free consultation by calling 701-297-2234.

Semrush Rank: 4,789,457
Categories: Business, Business

Similar?
Yes 0 No 0

macklawpa.com
Orlando Divorce Lawyer, Family Law, Criminal Defense | Mack Law, P.A.
Attorney Michael Mackhanlall practices Family Law in Orlando, including divorce, child support, & child custody. Expert criminal defense lawyer & personal injury lawyer. Mike Mackhanlall is a top Divorce Lawyer in the Orlando, Orange County, FL area. Mack Law can help. No consultation fees. Call Today 407-926-6613.

Semrush Rank: 3,337,763
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

orlandodivorcelawyers.net
Orlando Divorce Attorneys | The Sanders Firm, P.A.
Orlando divorce attorneys. We're a family, representing families. Offering 50 Years Combined Experience in Marital and Family Law.

Categories: Business, Business

Similar?
Yes 0 No 0

newdirectionfamilylaw.com
Divorce & Family Attorney In Raleigh - Prenups, Child Support & Custody
Building on over 30 years of family law experience in Raleigh and surrounding areas, we empower our clients and advocate for their best interests.

Categories: Business, Information Technology

Similar?
Yes 0 No 0

orlandodivorceteam.com
Orlando Divorce Lawyer | Orlando, FL Family Law Attorney
The Orlando divorce attorneys at Katz & Phillips handle all types of family law related cases to include divorce, alimony, spousal support and child custody matters.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

divorceorlando.net
Family Law Attorney: Winter Park, FL: Child Support & More
Dunlop, Dunlop & Dunlop, P.A. has been practicing family law since 1995. For attorneys with experience you can count on, call today.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

affordablefamilylawyer.com
Sean Smallwood, P.A. - Orlando
family lawyer
Find
out your odds of settlement from an experienced, professional, and strategic Orlando Family Lawyer Sean Smallwood. You need a trusted advisor.

Semrush Rank: 847,139
Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

ndhlaw.com
Orlando Divorce Lawyer - Natalie D. Hall, P.A.
Orlando Divorce Lawyer Natalie Hall is dedicated to professional one-on-one services for all clients in the areas of Family, Criminal, and Immigration Law.

Semrush Rank: 4,337,561
Categories: Business, Business

Similar?
Yes 0 No 0

vandersonlaw.com
Orlando Divorce Lawyer
Orlando divorce lawyers Anderson & Ferrin help with Florida family law, divorce, child custody, paternity, adoption, bankruptcy & loan modifications.

Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

donnahunglaw.com
Orlando Family & Divorce Lawyer
Orlando family & divorce lawyer Donna C. Hung handles divorce, child custody domestic violence, paternity, mediation & collaborative law & criminal defense.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

jmplawyer.com
JMP Lawyer | Orlando, Florida Divorce Attorney Home
JMP Law, P.A. serves families going through divorce in Orlando and Tampa,
Florida. With more than 15 years of combined experience, JMP Law has the
family attorneys to serve you.

Similar?
Yes 0 No 0

morse-firm.com
Orlando Divorce and Family Law Office | Law Office of Erin Morse
The Law Office of Erin Morse is an Orlando Divorce and Family Law Firm. We Put Your Family First and Provide Superior Representation. Schedule a Consultation Today.

Semrush Rank: 190,455
Categories: Business, Business

Similar?
Yes 0 No 0

thevelizlawfirm.com
Pardon Our Interruption

Categories: Business, Business

Similar?
Yes 0 No 0

thesmithfamilylawfirm.com
Altamonte Springs Divorce Attorneys
The Smith Family Law Firm, P.A. handles all types of family law, divorce and paternity cases. Contact our Orlando office for a free consultation.

Semrush Rank: 2,078,262
Categories: Business, Domain Parking

Similar?
Yes 0 No 0

yourattorneyinorlando.com
Abogados en Orlando Florida | Oficina Legal en Orlando
Abogados en Orlando: Somos una Oficina Legal en Orlando, trabamos diligentemente para proteger los derechos de nuestros clientes.

Moz DA: 22 Moz Rank: 3 Semrush Rank: 2,603,309 Facebook ♡: 1
Categories: Sports, Government and Legal Organizations

Similar?
Yes 0 No 0

arwanilawfirm.com
Orlando Divorce Lawyer
At the Arwani Law Firm our Orlando divorce lawyers work personally with our clients and tailor each case toward individual needs, contact us today.

Categories: Business, Business

Similar?
Yes 0 No 0

brownandrice.com
Brown & Rice - Orlando Attorneys -Divorce & Criminal Defense
Attorneys in Orlando. The Lawyers of Brown & Rice are standing by to help you through your criminal, divorce, or family case. (407) 956-2172

Semrush Rank: 49,911,158
Categories: Business, Business

Similar?
Yes 0 No 0

womensfamilylawfirm.com
Women's Family Law Firm
Christina M. Green is an Orlando Divorce Attorney. She is a litigator and represents clients throughout the entire State of Florida.

Semrush Rank: 8,142,080
Categories: Blogs/Wiki, Personal Websites and Blogs

Similar?
Yes 0 No 0

bauerfamilylaw.com
Bauer Family Law | Nashville Divorce Attorneys
Bauer Family Law - Divorce Attorney

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

aggressivefamilylaw.com
The Roberts Family Law Firm | Family Law Attorney in Orlando
Facing divorce? Family law issues? Our Orlando family law attorneys aggressively represent clients in family law matters. Call us at 407-426-6999

Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

sandrabonfiglio.com
Fort Lauderdale Divorce Attorney
Our Fort Lauderdale divorce attorneys work hard to obtain favorable results for our clients as efficiently as possible in all areas of Florida family law.

Moz DA: 24 Moz Rank: 3.5 Semrush Rank: 1,360,051 Facebook ♡: 1
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

familiaabogado.com
Orlando Family Law Firm | The Marin Law Firm
Dealing with a family legal issue in Orlando, FL? Contact The Marin Law Firm for legal help immediately. Se habla español.

Moz DA: 14 Moz Rank: 2.5 Semrush Rank: 4,506,341 Facebook ♡: 25
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

farberlawpa.com
Helena Farber | Family Law Advice | Divorce Lawyer in Florida
Helena Y. Farber (Divorce Lawyer In Miami, Florida) providing high quality legal representation to her clients in divorce and family law cases. Click!

Semrush Rank: 872,436
Categories: Business, Meaningless Content

Similar?
Yes 0 No 0

agoodblatt.com
Orlando Family Lawyer
The Orlando family lawyers at Goodblatt · Leo offer practical and goal-oriented representation in family law, divorce and bankruptcy matters.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

aubreylaw.com
Trust Administration Litigation Attorney | Family Law | Estate Planning
Aubrey Harry Ducker Jr. is an Trust Administration Litigation Attorney dedicated to resolving any elder law case. Call (407) 647-7887.

Semrush Rank: 2,963,420
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

waldlawoffice.com
West Palm Beach Divorce & Family Law Attorney | Jonathan D. Wald
For a West Palm Beach divorce lawyer, contact The Law Office of Jonathan D. Wald, P.A., by calling 561-328-0718.

Facebook ♡: 4
Categories: Business, Information Technology

Similar?
Yes 0 No 0

marseelaw.com
Orlando Divorce Attorney
Orlando divorce attorney, Steve W. Marsee, assists clients throughout Central Florida with sensitive and often complex marital and family law matters.

Semrush Rank: 517,637
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

morselaw.com
Orlando Divorce Attorney - Orlando Divorce Attorney Morse Law
Protect your children, net worth and lifestyle. 37 years of trial experience. Creative litigation and settlement solutions. Call for a private consultation.

Categories: Business, Business

Similar?
Yes 0 No 0

thevirgalawfirm.com
The Virga Law Firm, P.A. Florida Divorce Attorneys
Need help with a divorce matter? Discuss your case with a Florida divorce lawyer, such as myself, at The Virga Law Firm, P.A.! Case evaluations are available.

Semrush Rank: 799,273
Categories: Business, Business

Similar?
Yes 0 No 0

orlandolegal.com
Orlando Family Attorney
Orlando family attorneys providing compassionate yet aggressive help in divorce & child custody with large team of experienced lawyers & rising stars.

Semrush Rank: 687,173
Categories: Business, Business

Similar?
Yes 0 No 0

fldivorce.com
Orlando Divorce Lawyer | Free Consultation
The Orlando divorce lawyers at McMichen, Cinami & Demps have over 50+ years of combined experience. We offer a free consutlation.

Moz DA: 30 Moz Rank: 4.1 Semrush Rank: 164,047
Categories: Education/Reference, Reference

Similar?
Yes 0 No 0

thedavieslawfirm.com
Orlando Family Law Attorney | Orange County Divorce Lawyer
Orlando Family Law Attorney Once you have made the difficult decision to end your marriage, your next critical decision is selecting an attorney to steer you

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

llabona.com
Homepage | Central Florida Divorce Lawyers | Llabona Law Group
Our law practice is focused on family law. We provide caring and aggressive representation for divorce, alimony, child support, and other family law matters.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

devoelaw.com
Orlando Divorce Attorney
Orlando divorce attorney with 20 years experience. Divorce, child custody, timesharing, visitation, paternity, child support, and other family law cases.

Semrush Rank: 2,656,830
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

divorceattorneyorlando.us
Orlando Family Lawyer and Divorce Attorney | AAA Family Law
Call AAA Family Law at (407) 260-6001 for a consultation. We represent you
in divorce and post-divorce cases, such as alimony or child custody and
support, and in other family law cases, such as paternity disputes,
domestic violence injunctions, DCF state child dependency cases, and in
their appeals. We also help you with prenuptial agreements and child
adoptions by relatives.

Semrush Rank: 1,430,571
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

annmariegildenlaw.com
Orlando Family Law | Orlando Divorce Attorney | Ann Marie Gilden
Ann Marie Gilden, Esq. is a leading Orlando family law attorney that specializes in divorce, child custody, adoptions, paternity, and family mediation.

Semrush Rank: 2,660,888
Categories: Business, Business

Similar?
Yes 0 No 0

tampaflcriminaldefenselawyers.com
Criminal Defense Lawyer | St. Petersburg | The Law Office of Timothy Hessinger
The St. Petersburg criminal defense attorney at The Law Office of Timothy Hessinger is former prosecutor with 15+ years' experience. Free consultation!

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

mensdivorcelaw.com
Men's Divorce Law Firm | Orlando Divorce Attorneys
Men's Divorce Law Firm are experienced divorce attorneys, aggressively representing husbands & fathers in Orlando. Call our law firm today.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

westfamilylawgroup.com
Orlando Divorce & Family Law Attorneys | West Family Law Group
Orlando Divorce & Family Law Attorneys: West Family Law Group is a boutique marital & family law firm that advocates for your rights. Call 407-425-8878 today.

Semrush Rank: 2,686,562
Categories: Business, Business

Similar?
Yes 0 No 0

lewertlaw.com
Boca Raton Divorce Lawyer and Family Attorney - Lewert Law, LLC
Looking for an experienced Boca Raton Divorce lawyer? Tina L. Lewert, of Lewert Law, LLC is a board-certified Family Law Attorney.

Moz DA: 23 Moz Rank: 3.9 Semrush Rank: 742,437 Facebook ♡: 360
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

coralspringslaw.com
Coral Springs divorce lawyer | Parkland Alimony & Property Division Lawyer | Fort Lauderdale FL Child Custody Support
At the Law Offices of Mark Abzug, we help clients facing divorce or other family law matters. To discuss your legal needs in a FREE initial consultation, call our Coral Springs, Florida law office at (954) 753-1003.

Semrush Rank: 2,658,339
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

familylawfla.com
Fort Myers Family Law Attorneys | Divorce | Paternity
Skilled and experienced Fort Myers Family law attorneys. Learn more about us and how we can help you today.

Semrush Rank: 1,881,649
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

kmkaplanlaw.com
Miami Divorce Lawyer | Miami-Dade County Family Law Attorney | Kenneth M. Kaplan
Call (305) 666-9797 - Kenneth M. Kaplan is dedicated to helping individuals and families with family issues including Divorce and Family Law cases.

Semrush Rank: 4,235,070
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

abravermanlaw.com
Broward County Business Lawyer | Fort Lauderdale Civil Litigation Attorney | Stok Kon + Braverman
Free Consultation - Call 954-237-1777 - Stok Kon + Braverman helps companies with business issues including Business and Civil Litigation cases.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

jamiegrahamlaw.com
San Antonio Family Law Attorneys | Texas Military Divorce Lawyers
Call (210) 200-8850 The Family Law Attorneys at Jamie Graham & Associates, PLLC are on your side focused on helping military families in San Antonio and across Texas

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

wilsonlawteam.com
Wilson Law Firm - Orlando Divorce Attorneys & Orlando Criminal Lawyers - Orange County Criminal & DUI Attorneys - Orange County Divorce & Family Law Lawyers
Orlando Criminal Lawyers & Orlando Divorce Attorneys, Experienced Orange County FL Criminal Defense Attorneys, Divorce Lawyers and Family Law Attorneys

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

adamsluka.com
Orlando Criminal Defense Lawyer | Orange County, Florida Personal Injury Attorney | Adams & Luka
Free Consultation - Contact Us Now - Adams & Luka is dedicated to serving our clients with a range of legal services including Criminal Defense and Personal Injury cases.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

formydivorce.com
Divorce Custody Support and Alimony Attorneys & Lawyers in Florida
Aggressive and loyal attorneys helping you with divorce, custody, support, paternity, alimony & dependency. Our Consultations are Free. Call Now !

Semrush Rank: 1,807,872
Categories: Business, Information Technology

Similar?
Yes 0 No 0

militarydivorce.net
Winter Park Military Divorce Attorney | Law Office of Peter C. Cushing Attorney at Law
At the Law Office of Peter C. Cushing Attorney at Law in Winter Park, I help families with divorce, child custody and other family legal issues. Call 407-841-4543 for help with yours.

Semrush Rank: 3,174,231
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

floridadivorceme.com
Florida Divorce Attorney | Steven D. Miller, P.A. | Free Consultations
For advice from Florida Family Law and Divorce Lawyer Steven D. Miller, P.A., Contact our office at (954) 472-0776 and ask about his Family Law and Online Divorce Services. From Family Law and Child Custody to Child Support and Military divorces, we can help you.

Categories: Business, Business

Similar?
Yes 0 No 0

jimmullaney.com
Jacksonville Divorce Lawyer & Attorney | Law Office of A. James Mullaney
Law Office of A. James Mullaney - Family law attorney, mediator & divorce lawyer in Jacksonville FL handling family law cases exclusively for over 20 years.

Semrush Rank: 471,939
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

imaliklaw.com
Orlando Property Insurance Claims & Personal Injury Law Firm - Malik Law
Our attorneys have recovered millions of dollars for our clients in Orlando Property Insurance Claims & Accident and Injury cases throughout Florida.

Categories: Business,

Similar?
Yes 0 No 0

lafrancelaw.com
Tampa Divorce & Family Law Attorneys | LaFrance Family Law
LaFrance Family Law's singular focus is to provide you with the best representation possible, emphasizing diligence, personal attention, efficiency, and excellence in divorce, custody and all family law matters.

Semrush Rank: 502,790
Categories: Business, Finance and Banking

Similar?
Yes 0 No 0

floridasimpledivorce.com
Florida Simple Divorce | Cheap, Fast, Online
Click to have a Florida licensed Divorce Lawyer handle your fast Florida divorce from start to finish, without ever having to go to court | Florida Simple Divorce

Categories: Marketing/Merchandising, Reference

Similar?
Yes 0 No 0

bocaratondivorcelawyerblog.com
Boca Raton Divorce Lawyer Blog
Boca Raton Divorce Lawyer Blog — Published by Boca Raton and Fort Lauderdale Divorce Lawyer — Alan Robert Burton, Attorney at Law

Categories: Blogs/Wiki, Government and Legal Organizations

Similar?
Yes 0 No 0

familylawrights.blogspot.com
Family Law Rights
A blog about Tampa, Florida family law, divorce, alimony, child custody, parenting plans, time-sharing, equitable distribution, and relocation.

Semrush Rank: 30,983,720
Categories: Blogs/Wiki, Personal Websites and Blogs

Similar?
Yes 0 No 0

schwartz-white.com
Boca Raton Divorce Lawyer
Boca Raton divorce lawyers Schwartz | White help with complex divorce, elder law & Medicaid planning & asset protection.

Semrush Rank: 1,256,229
Categories: Business, Business

Similar?
Yes 0 No 0

mykramerlawfirm.com
Orlando Divorce Lawyers | Recognized as Best Lawyers in Orlando*
Orlando's attorneys at Kramer Law offer legal help with divorce, personal injury, business law, estate law, family law and foreclosure defense.

Moz DA: 30 Moz Rank: 3.8 Semrush Rank: 769,759
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

allanmanka.com
San Antonio Divorce Lawyer | Bexar County Family Law Attorney | The Law Offices of Allan R. Manka, P.C.
Free Consultation - Call (210) 824-1800 - The Law Offices of Allan R. Manka, P.C. is dedicated to helping individuals and families with family issues including Divorce and Family Law cases.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

dewittlaw.com
Orlando Divorce Lawyer | Dewitt Law
Divorce can be difficult but working with an Orlando Divorce Lawyer can help lessen the burden. Call Dewitt Law today to learn more.

Moz DA: 28 Moz Rank: 3.9 Semrush Rank: 418,224
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

fldivorceonline.com
Marital Separation Agreements (MSA)
Do-it-yourself Divorce Separation Agreements with detailed instructions, $39.00,100% Guaranteed.

Facebook ♡: 1
Categories: Public Information, Government and Legal Organizations

Similar?
Yes 0 No 0

brickelllegal.com
Miami Divorce & Family Law Attorney | Law Firm of Jeffrey Alan Aenlle, PLLC
Law Firm of Jeffrey Alan Aenlle, PLLC based in Miami, Florida. We are a boutique law firm that practices divorce & family law. Contact us at (786) 309-8588

Facebook ♡: 0
Categories: Business, Political Organizations

Similar?
Yes 0 No 0

draperlawoffice.com
Kissimmee Injury Lawyer
Draper Law Office is a boutique law firm focusing on personal injury and family law matters, contact our experienced Kissimmee injury lawyers today.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

Suggest Site to this list (wechsler-law.com)

Please only suggest if the website is similar. We do check suggested websites carefully and only approve if it's completely similar.

Site Url

Why do you think it is similar?

Email address We'll never share your email with anyone else. You'll get a confirmation email.

3 (times) seven

I'm sure it's similar Yes

wechsler-law.com Reviews

No reviews have been made yet.

What is sitelike.org?

sitelike.org is a free tool to search and find Similar Websites, alternatives or related to the given site.
It helps you to find similar sites based on keyword overlap and shared audience.
Our team is manually checking and finding similar websites and also our visitors are helping us to find the best similar websites.
"Similar sites like" first finds the best and top keywords for all websites and rank them.
We also use our internal algorithm with analysing the website contents and also several web sources to determine the main topics of websites which are used to find similar websites that have the closest matching set of topics. Our ranking system uses user generated content created by our team, our visitors and also our algorithm.