Similar sites like allentrafficticketlawyer.com

allentrafficticketlawyer.com Edit Report

Allen Traffic Ticket Lawyer | Attorney in Allen TX |

Allen Traffic Ticket Lawyer | Attorney in Allen TX |

Categories: Business, Government and Legal Organizations
Topics: allen traffic ticket lawyer, attorney in allen tx

Semrush Rank: 9,215,239

allentrafficticketlawyer.com Reviews

Sites similar to allentrafficticketlawyer.com - Top 12 allentrafficticketlawyer.com alternatives

planotrafficticketlawyer.com
Traffic Ticket Attorney in Plano | Speeding and Warrants Lawyer | Beltz Law Firm
Lawyers that defend tickets in Plano, Texas. Attorneys that can remove warrants for old tickets in Plano Municipal Court.

Moz DA: 12 Moz Rank: 2.5 Facebook ♡: 21
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

garlandtrafficticketlawyer.com
Garland Traffic Ticket Lawyer | Warrants Lifted In Garland
The Beltz Law firm specializes in traffic ticket defense for residents of Garland, Dallas, Plano, Farmers Branch, Grapevine, and surrounding areas.

Semrush Rank: 5,871,443
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

grandprairietrafficticketlawyer.com
Grand Prairie Traffic Ticket Lawyer | Warrants Lifted Attorney Texas |
Grand Prairie Traffic Ticket Lawyer | Warrants Lifted Attorney Texas |

Categories: Marketing/Merchandising, Newly Observed Domain

Similar?
Yes 0 No 0

beltzlaw.com
Beltz Law Firm | Dallas Traffic Ticket, Accident & Criminal Attorney
Beltz Law Firm is a top rated Dallas Law Firm. We provide legal services for injury cases, traffic tickets, criminal defense, and DUI as well as DWI.

Moz DA: 22 Moz Rank: 3.7 Semrush Rank: 637,049
Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

mesquitetrafficticketlawyer.com
Mesquite Traffic Ticket Lawyer | Mesquite Speeding Attorney
We are Mesquite traffic ticket attorneys that assist clients in the DFW area with all types of cases, which include speeding tickets, warrants, suspended

Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

omnibase.com
OmniBase Services
OmniBase, #failure to appear

Semrush Rank: 3,940,424
Categories: Government/Military, Government and Legal Organizations

Similar?
Yes 0 No 0

ticketattorneydallas.com
Dallas Texas Traffic Ticket Attorneys | Anderson & Anderson
Learn more about our traffic ticket attorney services and contact us for a consultation, we can take your call in English, Spanish, or French at (214) 370-8260.

Categories: Business, Political Organizations

Similar?
Yes 0 No 0

jackbynoattorney.com
Dallas-Fort Worth Traffic Ticket Attorney | Traffic Court, DWI, License Suspension
Have you been cited for a traffic violation in the Dallas-Fort Worth area? Call an attorney at Jack Byno & Associates at 817-685-0912. Representing DFW clients everywhere, including Arlington, Frisco, Irving, Denton, Mesquite and Allen, TX.

Facebook ♡: 0
Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

drivelegaltx.com
Stefanie Collins Attorney at Law
Stefanie Collins Attorney at Law

Semrush Rank: 2,396,705
Categories: Business, Business

Similar?
Yes 0 No 0

amtrib.com
Anna Melissa Tribune - Anna Melissa Tribune
Anna Melissa Tribune - Anna Melissa Tribune

Facebook ♡: 0
Categories: Sports, News and Media

Similar?
Yes 0 No 0

texasturf.org
Defending our property rights & freedom to travel :: Texans Uniting for Reform & Freedom
Texans Uniting for Reform and Freedom (TURF) a non-profit organization whose mission is to educate the public on our government’s new shift to tolling using controversial financing methods called public-private partnerships, the tolling of existing corridors, and the eminent domain abuse inherent in these plans. TURF is a grassroots group of Texans who are asking for reforms that require accountability and good public policy as well as promoting non-toll, sensible transportation solutions., Court rulings trend in favor of property rights, Toll agency denied federal TIFIA loan, trouble ahead for tolls in San Antonio, The NAFTA Superhighway yet to be built, TxDOT's ticking debt bomb, TSA spies on Houston buses?, Motorists pay vast majority of transportation taxes

Categories: Blogs/Wiki, Political Organizations

Similar?
Yes 0 No 0

phillydefenseattorneys.com
Philadelphia Criminal Defense Lawyers
If you have been accused of a crime in Pennsylvania, contact a Philadelphia criminal defense lawyer at Parkinson, Tarpey & Lloyd for a free consultation.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

Suggest Site to this list (allentrafficticketlawyer.com)

Please only suggest if the website is similar. We do check suggested websites carefully and only approve if it's completely similar.

Site Url

Why do you think it is similar?

Email address We'll never share your email with anyone else. You'll get a confirmation email.

3 (times) seven

I'm sure it's similar Yes

allentrafficticketlawyer.com Reviews

No reviews have been made yet.

What is sitelike.org?

sitelike.org is a free tool to search and find Similar Websites, alternatives or related to the given site.
It helps you to find similar sites based on keyword overlap and shared audience.
Our team is manually checking and finding similar websites and also our visitors are helping us to find the best similar websites.
"Similar sites like" first finds the best and top keywords for all websites and rank them.
We also use our internal algorithm with analysing the website contents and also several web sources to determine the main topics of websites which are used to find similar websites that have the closest matching set of topics. Our ranking system uses user generated content created by our team, our visitors and also our algorithm.