Similar sites like ticketattorneydallas.com

Dallas Texas Traffic Ticket Attorneys | Anderson & Anderson

Learn more about our traffic ticket attorney services and contact us for a consultation, we can take your call in English, Spanish, or French at (214) 370-8260.

Categories: Business, Political Organizations
Topics: anderson and anderson, city of dallas traffic ticket, dallas county traffic ticket, dallas deferred disposition, dallas dismissed ticket, dallas driving record, dallas texas traffic ticket attorneys, dallas ticket attorney, dallas traffic offense, dallas traffic ticket lawyer and warrant attorney, ticket attorney dallas, traffic ticket attorney dallas, traffic ticket attorney dallas county, traffic ticket dallas

ticketattorneydallas.com Reviews

Sites similar to ticketattorneydallas.com - Top 33 ticketattorneydallas.com alternatives

dallas-trafficticketlawyer.com
Dallas Traffic Ticket Lawyers | Dallas Ticket Attorneys | Affordable Legal Representation In Dallas For Those Accused Of Traffic, Misdemeanor, & Municipal Ordinance Violations
Dallas Traffic Ticket Dismissal From $40. Discounts For Multiple Tickets. 214 575 6060 for more information. Our Ticket Lawyers Lift Dallas Warrants Too.

Semrush Rank: 1,482,058
Categories: Marketing/Merchandising, Political Organizations

Similar?
Yes 0 No 0

cameronbyrdlaw.com
Dallas Traffic Ticket Lawyer | The Law Office of Cameron Byrd
Law Office of Cameron Byrd specializes in traffic tickets and warrant dismissal in Dallas Texas and the surrounding area.

Semrush Rank: 7,453,005
Categories: Business, Business

Similar?
Yes 0 No 0

londonlawdfw.com
Traffic Ticket Lawyer Dallas | Criminal Defense Attorneys | DWI Attorney
Our Criminal Defense Attorney Dallas can help you with your traffic ticket cases. Our areas of practice include criminal defense, immigration and much more. Call us today at 214-748-5200.

Facebook ♡: 0
Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

onlineticketlawyer.com
onlineticketlawyer.com
GoDaddy Security - Access Denied

Semrush Rank: 4,891,094
Categories: Business, Business

Similar?
Yes 0 No 0

goodticketlawyer.com
Effective Traffic Ticket & Misdemeanor Defense – 24/7/365
Effective Traffic Ticket & Misdemeanor Defense - 24/7/365

Semrush Rank: 6,221,414
Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

winocourlaw.com
Lawyer Services in Arlington Texas | Winocour Law
We are well-renowned Law Firm in Dallas, Texas, offering trusted and conservative expertise in a wide range of legal matters.

Semrush Rank: 3,101,510
Categories: Business, Business

Similar?
Yes 0 No 0

dallasattorney.org
Dallas Attorney – Dallas, TX – Law Offices of Martin J. Rubin
Dallas, TX Attorney Martin J. Rubin offers representation for traffic tickets, criminal defense, DWI. Call the Law Offices of Martin J. Rubin now!

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

jackpettit.com
Home
Rely on the 32 years of experience of the law of the Law Office of Jack Pettit for the efficient handling of your Dallas city and county traffic tickets. Call 214-521-4567 to schedule a consultation.

Semrush Rank: 3,581,348
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

beltzlaw.com
Beltz Law Firm | Dallas Traffic Ticket, Accident & Criminal Attorney
Beltz Law Firm is a top rated Dallas Law Firm. We provide legal services for injury cases, traffic tickets, criminal defense, and DUI as well as DWI.

Moz DA: 22 Moz Rank: 3.7 Semrush Rank: 637,049
Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

trafficticketsdallas.com
Traffic Ticket Defense | Dallas, TX | Meyer, Friedman, & Reed
Contact Meyer, Friedman, & Reed in Dallas, TX, at 214-979-9029 for expert legal counsel against Texas traffic violations.

Semrush Rank: 8,174,540
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

traylorlawfirm.com
Criminal Defense Attorney in Dallas, TX | Traylor Law Firm
Dallas, TX Criminal Defense Attorney | Have you been charged with a crime? | Are you being questioned by police? | Have you been arrested and need help? | Call Traylor Law Firm to protect your rights!

Semrush Rank: 1,410,970
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

omnibase.com
OmniBase Services
OmniBase, #failure to appear

Semrush Rank: 3,940,424
Categories: Government/Military, Government and Legal Organizations

Similar?
Yes 0 No 0

dallasattorney.com
Dallas Criminal Defense Attorneys | Berlof & Newton, P.C.,Attorneys at Law
The Dallas criminal defense attorneys at Berlof & Newton, P.C. have over 27 years of experience. Call the experienced Dallas lawyers today.

Facebook ♡: 13
Categories: Education/Reference, Reference

Similar?
Yes 0 No 0

jackbynoattorney.com
Dallas-Fort Worth Traffic Ticket Attorney | Traffic Court, DWI, License Suspension
Have you been cited for a traffic violation in the Dallas-Fort Worth area? Call an attorney at Jack Byno & Associates at 817-685-0912. Representing DFW clients everywhere, including Arlington, Frisco, Irving, Denton, Mesquite and Allen, TX.

Facebook ♡: 0
Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

benavideslawfirm.com
Traffic Ticket Attorney Houston | Criminal Defense Lawyer
Benavides Law Firm helps our clients fight tickets successfully. Kelly Benavides has a 10.0 Superb Avvo Rating and member National College for DUI Defense.

Semrush Rank: 8,085,469
Categories: Business, Business

Similar?
Yes 0 No 0

anallp.com
Anderson & Anderson LLP│安与恩咨询有限公司│Андерсон энд Андерсон ХХК
Anderson & Anderson LLP | 安与恩咨询有限公司

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

elpasotrafficticket.com
Traffic Ticket Lawyer El Paso - Warrant Attorney Robert Navar Call Today!
Traffic Ticket Attorney. I Can Help With Traffic Warrants From The El Paso Municipal Court And Justice Of The Peace. Call For A Free Consultation Hablamos Espanol

Semrush Rank: 570,641
Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

grandprairietrafficticketlawyer.com
Grand Prairie Traffic Ticket Lawyer | Warrants Lifted Attorney Texas |
Grand Prairie Traffic Ticket Lawyer | Warrants Lifted Attorney Texas |

Categories: Marketing/Merchandising, Newly Observed Domain

Similar?
Yes 0 No 0

andersonlf.com
Anderson & Anderson | Anderson & Anderson Law
Anderson & Anderson | Anderson & Anderson Law

Categories: Business, Business

Similar?
Yes 0 No 0

dwilegaldefense.com
Attorney, legal advice, traffic ticket defense, Montgomery Country, Texas | Robert Markowitz lawyer
Call Montgomery, Texas attorney Robert Markowitz for legal advice in traffic ticket defense, DWI, and license suspension.

Semrush Rank: 1,788,325
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

gregglawdallas.com
Law Offices of Robert Gregg
Whether you have been charged with a crime or injured in an accident, the Law Offices of Robert Gregg can fight for you. Schedule a free consultation with us today.

Semrush Rank: 2,073,737
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

thetrafficticketman.com
www.thetrafficticketman.com
www.thetrafficticketman.com

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

coppelltrafficticketlawyer.com
Coppell Traffic Ticket Lawyer | Speeding Ticket Attorneys |
Coppell Traffic Ticket Lawyer | Speeding Ticket Attorneys |

Semrush Rank: 57,666,451
Categories: Business, Business

Similar?
Yes 0 No 0

edgomezlaw.com
Edmund Gomez Law
Edmund Gomez Law

Semrush Rank: 2,949,141
Categories: Business, Business

Similar?
Yes 0 No 0

monkslaw.com
Monks Law Firm | Home | Houston Defense + Ticket Lawyers
Mike and Pat Monks are experienced, proven Houston attorneys with over 70 years of combined experience fighting for clients in a wide range of practice areas.

Semrush Rank: 1,980,425
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

trafficticketsjacksonville.com
No Points. Best Local Speeding Ticket Lawyer Jacksonville
Don't go to court. Don't miss work. Don't want the points? Jacksonville based, local Speeding Ticket Lawyers. The best value for the best lawyers $89.

Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

randyalpertlaw.com
Queens NY Traffic Violations Lawyer | Nassau County DWI Attorney
Contact New York traffic defense and criminal defense attorney Randy S. Alpert. Call 718-557-9748 or 516-231-9903.

Semrush Rank: 2,258,306
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

planotrafficticketlawyer.com
Traffic Ticket Attorney in Plano | Speeding and Warrants Lawyer | Beltz Law Firm
Lawyers that defend tickets in Plano, Texas. Attorneys that can remove warrants for old tickets in Plano Municipal Court.

Moz DA: 12 Moz Rank: 2.5 Facebook ♡: 21
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

theticketattorney.com
Houston Traffic Ticket Attorney - Eutsler Law Firm
Robert Eutsler has been providing affordable traffic ticket defense for all types of violations for over 15 years. For a free consultation call 713-464-6461.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

latrafficattorneys.net
Traffic Ticket Attorney DUI DMV Lawyer Speeding Drunk Driving Los Angeles
California Traffic and DUI Attorney / Lawyer Defends All Traffic Tickets or Traffic Violations Including Speeding Tickets, Radar Tickets, Red Light Camera Tickets, License Suspensions, Warrants, DUI, DWI, Drunk Driving, Failure To Appear (FTA), DMV Hearings For Commercial And Non-Commercial Drivers.

Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

hawkinswalker.com
Hawkins Walker, PC
Hawkins Walker, PC

Semrush Rank: 785,960
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

tkach-law.com
The Law Office of Todd E. Tkach, P.C.
Attorneys for personal injury, criminal defense, commercial driver license (CDL) violations plus traffic tickets and warrants.

Moz DA: 18 Moz Rank: 3.4 Semrush Rank: 934,018 Facebook ♡: 10
Categories: Business, Business

Similar?
Yes 0 No 0

mucklestone.com
Jeannie P. Mucklestone, PS, INC
Jeannie P. Mucklestone, PS, INC

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

Suggest Site to this list (ticketattorneydallas.com)

Please only suggest if the website is similar. We do check suggested websites carefully and only approve if it's completely similar.

Site Url

Why do you think it is similar?

Email address We'll never share your email with anyone else. You'll get a confirmation email.

3 (times) seven

I'm sure it's similar Yes

ticketattorneydallas.com Reviews

No reviews have been made yet.

What is sitelike.org?

sitelike.org is a free tool to search and find Similar Websites, alternatives or related to the given site.
It helps you to find similar sites based on keyword overlap and shared audience.
Our team is manually checking and finding similar websites and also our visitors are helping us to find the best similar websites.
"Similar sites like" first finds the best and top keywords for all websites and rank them.
We also use our internal algorithm with analysing the website contents and also several web sources to determine the main topics of websites which are used to find similar websites that have the closest matching set of topics. Our ranking system uses user generated content created by our team, our visitors and also our algorithm.