Similar sites like elpasotrafficticket.com

Traffic Ticket Lawyer El Paso - Warrant Attorney Robert Navar Call Today!

Traffic Ticket Attorney. I Can Help With Traffic Warrants From The El Paso Municipal Court And Justice Of The Peace. Call For A Free Consultation Hablamos Espanol

Categories: Marketing/Merchandising, Government and Legal Organizations
Topics: traffic ticket lawyer el paso, warrant attorney robert navar call today

Semrush Rank: 570,641

elpasotrafficticket.com Reviews

Sites similar to elpasotrafficticket.com - Top 76 elpasotrafficticket.com alternatives

trafficticketlawyerelpaso.com
Traffic Ticket Lawyer El Paso, TX Warrant Attorney Robert Navar
Traffic Ticket Lawyer or Warrants no problem, we can help. Call my office for a free consultation 915-613-3993. I handle all types of violations including animal control tickets.

Semrush Rank: 5,624,653
Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

aaronsonlawtx.com
El Paso, TX Traffic Law & Criminal Defense Attorney | Aaronson Law Firm
If you're searching for a lawyer in El Paso who will fight for your rights, contact Aaronson Law Firm. I'll work with you through the traffic law process.

Semrush Rank: 2,900,495
Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

trafficfirm.org
COMING SOON

Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

eptraffictix.com
Traffic Tickets And Probate Attorney El Paso TX
David Nevarez Attorney at Law is experienced in Traffic Tickets And Warrants, Powers Of, Last Will And Testament, Living Trust Plan, Wills and Probate, Probate With A Will, Probate With No Will and Residential Real Estate Law cases in El Paso TX. Call us at (915) 412-6818.

Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

goodticketlawyer.com
Effective Traffic Ticket & Misdemeanor Defense – 24/7/365
Effective Traffic Ticket & Misdemeanor Defense - 24/7/365

Semrush Rank: 6,221,414
Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

mytraffictickets.com
Best Traffic Ticket Dismissal Lawyers - MyTrafficTickets.com
My Traffic Tickets, a one-stop destination to take care of all traffic ticket needs with only the best customer service. Call us for Traffic Tickets Lawyers!

Semrush Rank: 682,395
Categories: Business, Business

Similar?
Yes 0 No 0

rubenortizlaw.com
El Paso Defense Attorney | Law Offices of Ruben Ortiz
Award-winning El Paso lawyer Ruben Ortiz handles criminal, personal injury and family law cases & has a record of success doing so. FREE consultation!

Moz DA: 23 Moz Rank: 3.2 Semrush Rank: 486,450
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

thetrafficticketman.com
www.thetrafficticketman.com
www.thetrafficticketman.com

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

monkslaw.com
Monks Law Firm | Home | Houston Defense + Ticket Lawyers
Mike and Pat Monks are experienced, proven Houston attorneys with over 70 years of combined experience fighting for clients in a wide range of practice areas.

Semrush Rank: 1,980,425
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

benavideslawfirm.com
Traffic Ticket Attorney Houston | Criminal Defense Lawyer
Benavides Law Firm helps our clients fight tickets successfully. Kelly Benavides has a 10.0 Superb Avvo Rating and member National College for DUI Defense.

Semrush Rank: 8,085,469
Categories: Business, Business

Similar?
Yes 0 No 0

ticketattorneydallas.com
Dallas Texas Traffic Ticket Attorneys | Anderson & Anderson
Learn more about our traffic ticket attorney services and contact us for a consultation, we can take your call in English, Spanish, or French at (214) 370-8260.

Categories: Business, Political Organizations

Similar?
Yes 0 No 0

dallas-trafficticketlawyer.com
Dallas Traffic Ticket Lawyers | Dallas Ticket Attorneys | Affordable Legal Representation In Dallas For Those Accused Of Traffic, Misdemeanor, & Municipal Ordinance Violations
Dallas Traffic Ticket Dismissal From $40. Discounts For Multiple Tickets. 214 575 6060 for more information. Our Ticket Lawyers Lift Dallas Warrants Too.

Semrush Rank: 1,482,058
Categories: Marketing/Merchandising, Political Organizations

Similar?
Yes 0 No 0

trafficticketsjacksonville.com
No Points. Best Local Speeding Ticket Lawyer Jacksonville
Don't go to court. Don't miss work. Don't want the points? Jacksonville based, local Speeding Ticket Lawyers. The best value for the best lawyers $89.

Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

thetrafficlawyers.ca
Traffic Lawyers® - DUI Impaired Driving Ontario Canada Refuse Breath Sample
The Traffic Lawyers is one of Ontario's only law firms with a team of lawyers & paralegals dedicated to defending driving offences. Get a free quote today!

Semrush Rank: 1,233,129
Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

randyalpertlaw.com
Queens NY Traffic Violations Lawyer | Nassau County DWI Attorney
Contact New York traffic defense and criminal defense attorney Randy S. Alpert. Call 718-557-9748 or 516-231-9903.

Semrush Rank: 2,258,306
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

bonniewolflaw.com
Traffic Ticket Attorney | Fort Worth | Bonnie Wolf Law
Bonnie Wolf is a determined traffic ticket attorney in Fort Worth. If you get a ticket, call the Wolf!

Semrush Rank: 1,146,934
Categories: Business, Business

Similar?
Yes 0 No 0

theticketattorney.com
Houston Traffic Ticket Attorney - Eutsler Law Firm
Robert Eutsler has been providing affordable traffic ticket defense for all types of violations for over 15 years. For a free consultation call 713-464-6461.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

x-cops.ca
≫Traffic Ticket Fighters & Traffic Lawyers in GTA & Ontario
We're licensed traffic ticket paralegals, lawyers & former police officers with 20+ years of experience. Need help after hours or at weekend? No problem.☎️Call us now: 416-901-3030.

Semrush Rank: 2,914,223
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

hawkinswalker.com
Hawkins Walker, PC
Hawkins Walker, PC

Semrush Rank: 785,960
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

trafficcounsel.com
Home page - Traffic Counsel
We are the best Missouri Traffic Lawyer and trusted by many. Need detailed information on missouri traffic law? Talk to Traffic Counsel now!

Semrush Rank: 692,858
Categories: Business, Advertising

Similar?
Yes 0 No 0

joynerlawfirm.com
Texas Law Firm | CDL Lawyer | Joyner + Joyner (210) 722-9089
Criminal defence law, traffic ticket law, personal injury law, CDL defense, and more. Call (210) 722-9089 to speak to a Texas law firm.

Semrush Rank: 964,429
Categories: Business, Business

Similar?
Yes 0 No 0

hersemlaw.com
Hersem Law | Tampa Criminal Defense Lawyer
Picking the right criminal defense attorney in Tampa will impact the severity of your sentence! Don't let a mistake ruin your life. Call 813-544-4162!

Moz DA: 24 Moz Rank: 3.3 Semrush Rank: 877,358
Categories: Business, Business

Similar?
Yes 0 No 0

texasticketbusters.com
Let Us Help You Drive Legally
Traffic Ticket Attorney Georgetown Tx-Let Us Help You Drive Legally with an Experienced Traffic Ticket Lawyer in Georgetown Tx. Speeding Ticket Lawyer Georgetown Tx

Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

wrplaw.net
Criminal Defense Attorney Winston-Salem, NC | Wood & Rabil, LLP
At Wood & Rabil, LLP you can partner with an experienced criminal defense attorney in the Winston-Salem area. Call now: (336) 722-5700

Semrush Rank: 4,704,675
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

londonlawdfw.com
Traffic Ticket Lawyer Dallas | Criminal Defense Attorneys | DWI Attorney
Our Criminal Defense Attorney Dallas can help you with your traffic ticket cases. Our areas of practice include criminal defense, immigration and much more. Call us today at 214-748-5200.

Facebook ♡: 0
Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

legalsolutionslawfirm.ca
Legal Solutions Law Firm | Toronto Criminal, Traffic Ticket, Family, Divorce Lawyers
Need a Criminal Lawyer, Traffic Ticket Lawyer, Family Lawyer, Divorce Lawyer, Small Claims Lawyer or any other Legal help? Legal Solutions Law Firm offers personalized service & affordable skilled legal defence. FREE no obligation Consultation - Call or Text: 416-320-2020

Semrush Rank: 9,857,279
Categories: Business, Web Hosting

Similar?
Yes 0 No 0

vegasticketfix.com
Traffic Ticket Attorney Located in Las Vegas | Vegas Ticket Fix
Traffic ticket attorney serving Las Vegas, call (702) 608-3030. Vegas Ticket Fix offers legal advice and guidance when you need it most.

Semrush Rank: 1,827,619
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

grandprairietrafficticketlawyer.com
Grand Prairie Traffic Ticket Lawyer | Warrants Lifted Attorney Texas |
Grand Prairie Traffic Ticket Lawyer | Warrants Lifted Attorney Texas |

Categories: Marketing/Merchandising, Newly Observed Domain

Similar?
Yes 0 No 0

thompson-trafficlawyers.com
Got a Traffic Ticket or Traffic Accident?
Thompson Traffic Lawyers has over 20 years experience handling tickets. No DMV points, No traffic school, No insurance increase, No going to court, and a reduced fine. Call (702) 383-6040 for the best Traffic Ticket Lawyers in Las Vegas, NV.

Semrush Rank: 1,024,786
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

trafficticket.legal
Traffic Ticket Lawyer & Paralegals Toronto | Fight Traffic Tickets
TrafficTicket.Legal: Expert Traffic Ticket Lawyer & Paralegals Toronto. Fight traffic tickets, speeding tickets, DUI charges etc.Free Consultation: 416-835-7411

Semrush Rank: 10,948,885
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

traffic-ticket-attorney.com
Traffic Ticket Attorney Los Angeles | Speeding Ticket Lawyers LA
Mr. Ellison is a trial attorney who exclusively practices traffic ticket & criminal defense. Best Traffic Ticket Attorney In The State of California! Get a free evaluation!

Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

glaw.me
Traffic Ticket Lawyer Houston - Gilligan Law Firm
We would be pleased to discuss any legal issue to find out how we may be of service to you. We are an experienced traffic ticket lawyer in Houston.

Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

latrafficattorneys.net
Traffic Ticket Attorney DUI DMV Lawyer Speeding Drunk Driving Los Angeles
California Traffic and DUI Attorney / Lawyer Defends All Traffic Tickets or Traffic Violations Including Speeding Tickets, Radar Tickets, Red Light Camera Tickets, License Suspensions, Warrants, DUI, DWI, Drunk Driving, Failure To Appear (FTA), DMV Hearings For Commercial And Non-Commercial Drivers.

Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

abramdefense.com
Delaware Criminal Defense Firm
At Abram and Hutchison, our Delaware criminal defense attorney is available 24/7. Call now to get started with your FREE consultation!

Semrush Rank: 3,513,234
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

lyattorneys.com
Roberto Yranela & Associates - Traffic Ticket & DUI Defense
Roberto Yranela & Associates - traffic ticket & DUI defense lawyers will fight your ticket for you. Call for a free consultation today! 425-260-9366.

Semrush Rank: 5,058,021
Categories: Business, Business

Similar?
Yes 0 No 0

masstsang.com
Mass Tsang
We at Mass Tsang are passionate about defending the rights of individuals across Toronto and surrounding areas. Our firm specializes exclusively in criminal law, enabling us to provide focused and effective advocacy in criminal defence cases. From DUIs to serious criminal charges, our team's in-depth experience and proactive approach allow us to navigate the complexities of each case. We are committed to maintaining clear communication, offering 24/7 support, and crafting strong defence strategies to safeguard our clients’ freedom and reputation.
Address: 5075 Yonge St Suite 501, Toronto, ON M2N 6C6 Canada
Phone: +1 416-907-4097

Semrush Rank: 3,115,307
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

cameronbyrdlaw.com
Dallas Traffic Ticket Lawyer | The Law Office of Cameron Byrd
Law Office of Cameron Byrd specializes in traffic tickets and warrant dismissal in Dallas Texas and the surrounding area.

Semrush Rank: 7,453,005
Categories: Business, Business

Similar?
Yes 0 No 0

kuboshlaw.com
Paul Kubosh, Attorney at Law | Harris County Traffic Ticket Lawyers
Pulled over? Arrested? Trust our Harris County traffic ticket attorneys at the office of Paul Kubosh, Attorney at Law for a free consultation.

Semrush Rank: 378,511
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

txattorney.us
Abilene & San Angelo Criminal Defense Lawyer | Law Offices of David M. White
The Law Offices of David M. White provides criminal & personal injury representation to people in Abilene, San Angelo, and the surrounding areas. Free consult!

Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

mucklestone.com
Jeannie P. Mucklestone, PS, INC
Jeannie P. Mucklestone, PS, INC

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

elimitix.com
Traffic Violation Attorney Detroit MI | Traffic Law Firm Southfield MI
Seeking a traffic violation attorney in Michigan? ElimiTix is your one-stop traffic law firm, helping protect your rights, and getting you the desired outcome.

Moz DA: 20 Moz Rank: 2.9 Semrush Rank: 2,225,434 Facebook ♡: 1,188
Categories: Marketing/Merchandising, ???

Similar?
Yes 0 No 0

yourtrafficticketlawyer.com
Speeding Ticket Attorney in Kansas City, MO | Your Traffic Ticket Lawyer, LLC
Need help with tickets or license issues? Call the attorneys at Your Traffic Ticket Lawyer, LLC in Kansas City, Missouri today to schedule a free consultation.

Semrush Rank: 3,628,275
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

traffictx.com
Mallory, Lollar, Holt & Associates, P.C.
Leading Traffic Ticket & Criminal Defense Attorneys for more than 45 Years

Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

ticketlawyersbroward.com
Traffic Ticket Lawyers at Traffic Ticket Legal Center
Don't Settle For Points On Your License. Traffic Ticket Lawyers and the Law Office of Robert Shapiro in Miami-Dade, Broward and Palm Beach counties Florida.

Semrush Rank: 7,832,994
Categories: Business, Political Organizations

Similar?
Yes 0 No 0

babkeslaw.com
Home | Somera & Associates, P.A. | Personal Attorney | Palm Beach |
Somera & Associates, P.A. is a family owned business providing quality legal services throughout the state of Florida since 1998.

Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

moffitt.law
Welcome to The Law Office of Philip Moffitt - The Law Office of Philip Moffitt, P.A.
*ON VACATION 8/3-8/7 2023, EMAIL OR USING ONLINE HIRING FORM FOR CIVIL TICKETS IS THE BEST WAY TO REACH ME* Experienced traffic ticket defense at an affordable

Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

sanantonioticketlaw.com
Joyner + Joyner, P.C. All rights reserved.
Joyner + Joyner, P.C. All rights reserved.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

floridaticketfirm.com
Home Page | GV Books

Semrush Rank: 638,219 Facebook ♡: 75
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

justiceforcolorado.com
Denver Personal Injury and Traffic Ticket Lawyers | Justice for Colorado
Injured in an accident? Facing criminal charges? Contact Justice for Colorado for a free consultation by clicking through to this page!

Semrush Rank: 937,479
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

criminalattorneylongislandny.com
Long Island Criminal Lawyer | Mirsky Law Firm
If accused of a crime, you need an aggressive Long Island criminal defense attorney with years of experience. Call the Mirsky Law Firm at 516-299-6187 now!

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

sullolaw.com
Sullo & Sullo | Houston Criminal Lawyer | Houston Criminal Attorney
Since its inception, Sullo & Sullo has represented over 275,000 clients in a variety of areas including Criminal Defense, Personal Injury, Traffic Tickets, and Immigration. Sullo & Sullo is ranked on Yelp's List of the Best 10 Lawyers in Houston. We have earned substantial verdicts for our Personal Injury Clients and have successfully defended hundreds of Criminal Cases in Harris County.

Categories: Public Information, Government and Legal Organizations

Similar?
Yes 0 No 0

ticketdefenders.ca
Ticket Defenders - Ontario Careless Driving Lawyer OT Stunt Speeding
Ticket Defenders-Ticket Defenders Professional Corporation. Ticket Defenders your #1 Ticket Lawyers at successfully defending careless driving tickets, stunt summons, speeding, drive suspended, no insurance, and OT charges. We are the originals and Ticket Defenders is our Registered Canadian Trademark, Ontario, Canada.

Semrush Rank: 2,552,896 Facebook ♡: 191
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

newmexicotrafficticket.com
New Mexico Traffic Ticket Lawyer | Albuquerque Speeding Violation Attorney | Glenn Smith Valdez
Free Consultation - Call (505) 877-8787 - Glenn Smith Valdez aggressively represents the accused against charges in Traffic Ticket & Speeding Violation cases.

Semrush Rank: 2,159,649
Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

kctrafficlawyer.com
Traffic Lawyer in Kansas City | The KC Traffic Lawyer
Timothy R. Tompkins, the KC Traffic Lawyer, has represented clients in courts all around the Kansas City metropolitan area. He can help you, too.

Semrush Rank: 1,248,650
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

onlineticketlawyer.com
onlineticketlawyer.com
GoDaddy Security - Access Denied

Semrush Rank: 4,891,094
Categories: Business, Business

Similar?
Yes 0 No 0

trafficlawsolutions.net
Traffic Lawyer St. Louis, Missouri | TRAFFIC LAW SOLUTIONS
Speeding tickets for $38! Call TRAFFIC LAW SOLUTIONS in St. Louis, Missouri. Keep your driving record clean and insurance rates low! Traffic Lawyer St Louis

Categories: Business, Business

Similar?
Yes 0 No 0

robertsandelliott.com
San Jose Criminal Defense Lawyers - Roberts | Elliott Law Corp.
Charged with drunk driving (DUI), drug and marijuana crimes, or any other crime? Our San Jose Criminal Defense Lawyers will zealously protect your rights.

Semrush Rank: 4,800,850
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

trafficticket-attorney.com
Nationwide & California traffic ticket attorney - speeding violation, DUIs, overweight - traffic ticket lawyer - commercial driver legal defense in California - taxi drivers, truck drivers
Need a top Nationwide or California traffic ticket attorney or lawyer? Over 20 years experience in fighting ALL Traffic Ticket Violation Cases, and are operating in every court in California. Commercial truck driver cases are our specialty. Legal defense for overweight/length, speeding, speeding over 100, hazmat, mechanical violations, too many points, DMV hearings, drunk driving, drug-related matters, removal of points, wrong/out-of-lane, illegal parking, and many more. We have lawyers in all 172 traffic courts in California that are familiar with the courts, the judges, district attorneys, and the police officers that regularly appear in that court.

Facebook ♡: 15
Categories: Marketing/Merchandising, Political Organizations

Similar?
Yes 0 No 0

ticketsave.ca
Traffic Tickets Paralegals in Toronto. We fight your speeding tickets, driver's license suspension and all major traffic offenses. 5 star reviews! Free consultation.
Traffic Tickets Paralegals in Toronto. We fight your speeding tickets, driver's license suspension and all major traffic offenses. 5 star reviews! Free consultation.

Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

texasdrivesafe.com
Texas Defensive Driving Course Online | State Approved Driver Safety Course - TexasDriveSafe.com
Texas defensive driving course for only $25, which is the lowest allowed by law and available online 24/7 from PCs, tablets, or mobile devices.

Semrush Rank: 1,937,386
Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

lvtrafficticketguy.com
Home - LV Traffic Ticket Guy
Home - LV Traffic Ticket Guy

Semrush Rank: 1,421,530
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

houstonticketlawyer.com
Houston Traffic Ticket Attorney & Speeding Ticket Lawyer
Houston Traffic Ticket Attorney - Let us put our years of experience to work for you. City of Houston,
Justice of the Peace, municipal courts in Harris County. Traffic lawyer and bondsman.

Moz DA: 9 Moz Rank: 3.5 Semrush Rank: 1,050,717
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

nooneyandroberts.com
Jacksonville Personal Injury Lawyer | Duval County, Florida Criminal Defense Attorney | Nooney & Roberts
Free Consultation - Call (904) 398-1992 - Nooney & Roberts is dedicated to providing our clients with legal services in Personal Injury and Criminal Defense cases.

Semrush Rank: 35,343,620
Categories: Internet Services, Government and Legal Organizations

Similar?
Yes 0 No 0

denvertrafficlawyer.com
Colorado Traffic Lawyer — Traffic Ticket & Drivers License Attorney
Colorado Local Traffic Lawyer — Need a Traffic Ticket Attorney or a Drivers License Attorney? Call for a Free Case Review or Visit Our Website for More Information.

Moz DA: 53 Moz Rank: 4.3 Semrush Rank: 966,032
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

trafficlawcenters.com
TLC - Traffic Law Center
Traffic Law Center official site. Get in touch to see how our attorneys can
help you with your traffic ticket today. Our lawyers handle speeding
tickets, DUIs/DWIs, driving without insurance tickets, license suspension &
more in the states of Missouri, Illinois, & Kansas.

Moz DA: 24 Moz Rank: 3.5 Semrush Rank: 297,832
Categories: Online Shopping, Government and Legal Organizations

Similar?
Yes 0 No 0

goldentrafficticketlaw.com
Florida Traffic Ticket Attorney
Facing a traffic violation charge? Traffic ticket lawyer in Florida John Golden has been the attorney of record on more than 50,000 cases. Schedule a FREE consult today!

Semrush Rank: 1,409,588
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

springfieldtraffictickets.com
Springfield Traffic Tickets: Traffic Ticket Attorney in Springfield, MO
If you've received a traffic citation, let an experienced traffic ticket attorney in Springfield, MO represent you in court. Our traffic ticket lawyers can help keep points from appearing on your license so you can get back on the road. We can even appear in court on your behalf.

Semrush Rank: 1,175,915
Categories: Business, Business

Similar?
Yes 0 No 0

kcticketlaw.com
Traffic Lawyer | Speeding | DUI | Criminal Defense Attorney
Our Kansas City traffic lawyers & speeding ticket attorneys assist with speeding & traffic tickets, DUI, and criminal law violations in Kansas & Missouri.

Facebook ♡: 0
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

xcopper.com
Traffic and Criminal Defence Lawyer - X-Copper
Canada's leading legal defence team. Professional and affordable representation for traffic tickets and criminal charges.

Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

dennislopezlaw.com
DUI & Traffic Ticket Attorneys in Tampa | Florida Criminal Defense Law Firm | Dennis A. Lopez, Attorney at Law
If you've received a DUI charge or traffic ticket in Tampa, contact Dennis A. Lopez, Attorney at Law for skilled representation.

Semrush Rank: 1,949,572
Categories: Business, Business

Similar?
Yes 0 No 0

speedingticketkc.com
Home - Speeding Ticket KC-Traffic Lawyers In Kansas City
Traffic Lawyers In Kansas City Handling Traffic Tickets.kansas city traffic lawyers,traffic lawyer kansas city,traffic lawyer kansas city mo.

Facebook ♡: 0
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

pointts.com
POINTTS™ The Traffic Ticket Specialists
POINTTS™ The Traffic Ticket Specialists is the first and largest firm of independent paralegals to offer legal services in Canada. We fight for you!

Semrush Rank: 2,104,215 Facebook ♡: 72
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

otdlegal.ca
Ontario Ticket Defence Legal Services | OTD Legal
We provide ticket defence for clients across Ontario to help fight charges of careless driving, speeding, car accident offences, and driving violations.

Semrush Rank: 1,071,096
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

bernsteinlawgroup.ca
Criminal & Personal Injury Lawyers | Bernstein Law Group Hamilton, ON
Call 905-546-1990 if you have been charged with a crime in Hamilton or if you have legal concerns related to mental-health, consent or capacity.

Semrush Rank: 2,956,231
Categories: Business, Information Technology

Similar?
Yes 0 No 0

lvticketattorney.com
Traffic Ticket & Warrant Resolution
las vegas traffic ticket, fix las vegas traffic ticket, las vegas dui,

Facebook ♡: 128
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

tampaticketattorney.com
tampaticketattorney.com - Domain Name For Sale | DAN.COM
The domain name TampaTicketAttorney.com is for sale. Make an offer or buy it now at a set price.

Facebook ♡: 5
Categories: Marketing/Merchandising, Political Organizations

Similar?
Yes 0 No 0

Suggest Site to this list (elpasotrafficticket.com)

Please only suggest if the website is similar. We do check suggested websites carefully and only approve if it's completely similar.

Site Url

Why do you think it is similar?

Email address We'll never share your email with anyone else. You'll get a confirmation email.

3 (times) seven

I'm sure it's similar Yes

elpasotrafficticket.com Reviews

No reviews have been made yet.

What is sitelike.org?

sitelike.org is a free tool to search and find Similar Websites, alternatives or related to the given site.
It helps you to find similar sites based on keyword overlap and shared audience.
Our team is manually checking and finding similar websites and also our visitors are helping us to find the best similar websites.
"Similar sites like" first finds the best and top keywords for all websites and rank them.
We also use our internal algorithm with analysing the website contents and also several web sources to determine the main topics of websites which are used to find similar websites that have the closest matching set of topics. Our ranking system uses user generated content created by our team, our visitors and also our algorithm.

20
Visited: 20 times