Similar sites like floridasexcrimeattorney.com

Florida Sex Crime Defense Lawyers | FL Sexual Assault Attorneys | Whittel & Melton

Free Consultation - Call (866) 608-5529 - Whittel & Melton aggressively represents the accused against charges in Sex Crime & Sexual Assault cases.

Categories: Business, Government and Legal Organizations
Topics: fl sexual assault attorneys, florida sex crime defense lawyers

Semrush Rank: 2,567,823

floridasexcrimeattorney.com Reviews

Sites similar to floridasexcrimeattorney.com - Top 58 floridasexcrimeattorney.com alternatives

gilschaffnit.com
Gainesville Criminal Defense Lawyer
Gainesville criminal defense lawyer Gilbert A. Schaffnit helps with Florida s*x crimes, drug charges, weapons offense, violent crimes, theft, DUI & more.

Semrush Rank: 518,226
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

donwaggonerlaw.com
Kissimmee & Orlando Law | Don Waggoner
Don Waggoner Law, P.A. represents criminal clients in Orlando Kissimmee, Winter Park, Ocoee, Apopka, Sanford, Viera, Barlow and Deland. He is available throughout Florida on a case-by-case basis.

Categories: Business, Business

Similar?
Yes 0 No 0

davidolsonlaw-firm.com
Criminal Defense Attorney West Palm Beach | Home | David Olson Law
Criminal Defense Attorney West Palm Beach | Home | David Olson Law

Semrush Rank: 727,718 Facebook ♡: 862
Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

feller-law.com
Criminal, Personal, Family Law Attorney | Lake Mary, Sanford, FL | Feller Law, P.A.
Feller Law, P.A. is a criminal law firm covering the metro Orlando area. Our areas of expertise includes DUI, criminal, family, personal injury law & more.

Semrush Rank: 3,049,453
Categories: Business, Business

Similar?
Yes 0 No 0

floridacapitalresourcecenter.org
Florida Capital Resource Center
Florida Capital Resource Center

Categories: Non-Profit/Advocacy/NGO, Government and Legal Organizations

Similar?
Yes 0 No 0

nooneyandroberts.com
Jacksonville Personal Injury Lawyer | Duval County, Florida Criminal Defense Attorney | Nooney & Roberts
Free Consultation - Call (904) 398-1992 - Nooney & Roberts is dedicated to providing our clients with legal services in Personal Injury and Criminal Defense cases.

Semrush Rank: 35,343,620
Categories: Internet Services, Government and Legal Organizations

Similar?
Yes 0 No 0

south-floridaattorney.com
South Florida Personal Injury Attorneys | Falk & Ross Law Firm
Recovered Millions in Verdicts and Settlements – Over 40 Years of Experience in Florida Criminal Case Or Personal Injury We Can Help! Have you recently been in a car accident? Have you slipped and fell and sustained an injury? Are you trying to represent yourself in court? Have you been charged with a misdemeanor/felony? Have you been charged with possession ... Read More

Semrush Rank: 2,813,217
Categories: Business, ???

Similar?
Yes 0 No 0

jansenlawoffice.com
Tallahassee Criminal Defense Firm | Jansen and Davis, P.A.
If you need serious representation for criminal charges, contact a Tallahassee, FL criminal defense attorney at the Law Offices of Jansen and Davis, P.A.

Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

criminallawyerwestpalmbeach.com
West Palm Beach Criminal Defense Lawyer - Palm Beach County Criminal Attorney - Boca Raton Crime Lawyer
Free Consultation - Richard Tendler - West Palm Beach Criminal Defense Lawyer - Palm Beach County Criminal Attorney - Boca Raton Crime Lawyer

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

justiceflorida.com
Criminal Defense Lawyer West Palm Beach | Call Today (561) 832-4348
Looking for a criminal defense lawyer in West Palm Beach? Criminal lawyer Ron Chapman helps those accused of DUI, Drug crimes and s*xual offenses.

Facebook ♡: 0
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

romanromanlaw.com
Clearwater Personal Injury Attorney
The Clearwater personal injury attorneys of Roman & Roman are highly experienced and dedicated to helping our clients.

Categories: Business, Business

Similar?
Yes 0 No 0

ralphbehr.net
Fort Lauderdale Criminal Defense Lawyer | Miami Criminal Attorney | Ralph Behr
Free Consultation - Call (800) 761-3446 - Law Offices of Ralph Behr aggressively represents the accused against charges in Criminal Defense & Criminal cases.

Moz DA: 21 Moz Rank: 2.9 Semrush Rank: 659,426 Facebook ♡: 5
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

tampafloridacriminallawyer.com
Tampa Criminal Lawyer | Hillsborough County Criminal Defense Attorney | The Mayberry Law Firm
Free Consultation - Call (813) 444-7435 - The Mayberry Law Firm aggressively represents the accused against charges in Criminal & Criminal Defense cases.

Semrush Rank: 902,556
Categories: Sports, Business

Similar?
Yes 0 No 0

parksandbraxton.com
Miami DUI Lawyer | Criminal Defense Attorneys Miami | Parks & Braxton, PA
Need Miami DUI Lawyers - MIami Criminal Defense Lawyers? Call us for FREE consultation. We're here 24/7. 305-928-1791

Categories: Non-Profit/Advocacy/NGO, Government and Legal Organizations

Similar?
Yes 0 No 0

locatethelaw.org
Home - Locate the Law
Home - Locate the Law

Categories: Business, Business

Similar?
Yes 0 No 0

floridaoffenderalert.com
Florida Offender Alert System
Insert Description Here

Facebook ♡: 319
Categories: Government/Military, Government and Legal Organizations

Similar?
Yes 0 No 0

hosttransitionservices.com
H.O.S.T. Transition - Sex Offender Housing & Transition
H.O.S.T. Transition Services provides s*x offender housing, s*x offender transition consulting and s*x offender resources for offenders.

Semrush Rank: 8,125,176
Categories: Business, Business

Similar?
Yes 0 No 0

thefordfirm.com
thefordfirm.com - Domain Name For Sale | DAN.COM
The domain name thefordfirm.com is for sale. Make an offer or buy it now at a set price.

Categories: Business, Business

Similar?
Yes 0 No 0

floridaatsa.com
Florida ATSA - Florida State Chapter of ATSA
Florida ATSA - Florida State Chapter of ATSA

Semrush Rank: 3,393,491
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

galiganilaw.com
Galigani Law Firm
If you are facing a DUI, misdemeanor, or felony charge, contact an experienced attorney at Galigani Law Firm. Lawyer representing Gainesville, Ocala, Lake City, Alachua and surrounding counties.

Semrush Rank: 699,368
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

adamsluka.com
Orlando Criminal Defense Lawyer | Orange County, Florida Personal Injury Attorney | Adams & Luka
Free Consultation - Contact Us Now - Adams & Luka is dedicated to serving our clients with a range of legal services including Criminal Defense and Personal Injury cases.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

richardhornsby.com
Orlando Criminal Defense Attorney Richard Hornsby
Orlando criminal defense lawyer Richard Hornsby (407-540-1551) represents criminal defense, DUI, and juvenile clients in Central Florida and the greater Orlando area.

Moz DA: 47 Moz Rank: 3.9 Facebook ♡: 0
Categories: Non-Profit/Advocacy/NGO, Government and Legal Organizations

Similar?
Yes 0 No 0

womenagainstregistry.org
Women Against Registry - Home
Women Against Registry - Home

Semrush Rank: 1,339,161
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

halberglaw.com
West Palm Beach Personal Injury Lawyer | Miami Accident Attorney | Halberg & Fogg PLLC
Free Consultation - Call 877-425-2374 - Halberg & Fogg PLLC helps victims and their families receive compensation for their injuries in Personal Injury and Accident cases.

Categories: Business, Reference

Similar?
Yes 0 No 0

criminaldefenselawyersinorlando.com
Orlando Criminal Defense Attorneys | Winter Park FL Criminal Law
Schedule a confidential consultation with our Orlando criminal defense attorneys. We can be reached 24/7 and are available for emergency bond and trial hearings.

Semrush Rank: 757,886
Categories: Sports, Government and Legal Organizations

Similar?
Yes 0 No 0

goldmanwetzel.com
Criminal Defense Attorneys St. Petersburg, FL | Goldman Wetzel
Facing criminal charges? Early legal intervention is critical! St. Petersburg criminal attorneys Goldman Wetzel can help: 727-828-3900.

Semrush Rank: 530,639
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

criminalattorneytampa.net
Criminal Defense Attorney in Tampa, FL - Hanlon Law
Criminal Defense Attorney in Tampa, FL - Hanlon Law | Florida-based criminal defense law firm Hanlon Law is full of winning lawyers. We aggressively defended clients all across FL. Let us fight for you and help you win the fight. Visit our website or call us at (813) 228-7095 to schedule your consultation today!

Semrush Rank: 623,400
Categories: Business, Business

Similar?
Yes 0 No 0

labaradams.com
Home | LABARADAMS
LaBar & Adams, P.A. is committed to seeking justice for Employees and those injured due to the negligence of another.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

coreycohen.com
Orlando Criminal Defense Law Firm | Corey Cohen & Associates
At The Law Office of Corey I. Cohen, our criminal defense attorney is a former prosecutor with decades of experience. Call our Orlando firm: 407-246-0066

Semrush Rank: 244,922
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

rpfoley.com
West Palm Beach Criminal Lawyer | Palm Beach County Criminal Defense Attorney | The Law Offices of Roger P. Foley, P.A.
Call (561) 746-7076 for a free 15 minute case strategy. The Law Offices of Roger P. Foley, P.A. is a Criminal Defense firm practicing in Palm Beach, Broward, and Martin Counties, and throughout Florida.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

tampacriminalattorneys.com
Tampa Criminal Defense & DUI Lawyers | Thomas & Paulk
Get a FREE case evaluation with Tampa criminal defense & DUI attorneys at Thomas & Paulk. Thousands of cases handled. Decades of experience. Available 24/7!

Moz DA: 26 Moz Rank: 3.3 Semrush Rank: 366,793
Categories: Business, Business

Similar?
Yes 0 No 0

escobarlaw.com
Criminal Defense Attorney Tampa, FL | DUI Defense
Call the experienced Tampa, Florida, criminal defense attorneys at Escobar, Michaels & Associates at 813-513-0274 for a free consultation.

Categories: Business, Web Hosting

Similar?
Yes 0 No 0

tampaflcriminaldefenselawyers.com
Criminal Defense Lawyer | St. Petersburg | The Law Office of Timothy Hessinger
The St. Petersburg criminal defense attorney at The Law Office of Timothy Hessinger is former prosecutor with 15+ years' experience. Free consultation!

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

markjobrien.com
Tampa Criminal Defense Lawyer | O'Brien Hatfield, P.A.
Superb 5.0 rated criminal defense attorneys. Tampa, Florida-based law firm O’Brien Hatfield, P.A. Available 24/7 Call 813-440-2347 for a free, private case review.

Semrush Rank: 416,417 Facebook ♡: 66
Categories: Sports, Government and Legal Organizations

Similar?
Yes 0 No 0

melbournedefenselaw.com
Criminal Attorney Melbourne FL Lawyer
Richard G. Canina, P.A., a criminal defense law office in Melbourne, Florida, handling all felony and misdemeanor cases. FREE CONSULTATIONS call 321-728-0989. Available 24/7.

Semrush Rank: 1,474,204
Categories: Business, Business

Similar?
Yes 0 No 0

needleellenberg.com
Personal Injury Lawyers Miami Florida - Needle & Ellenberg, P.A.
The Miami personal injury lawyers of Needle & Ellenberg, P.A., strive to provide the best professional services for our clients’ needs and interests. We are highly selective about the cases we will accept so we can ensure the best outcome for the circumstances of your case.

Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

communitylawfirm.com
Daytona Beach Lawyers | Aaron Delgado & Associates
Experienced Daytona Beach Criminal Defense Lawyers, DUI Lawyers, and Family Lawyers. We’re here to help you 24/7. Flexible Lawyer Payment Plans.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

felonyflorida.com
West Palm Beach Criminal Lawyer | Palm Beach County Criminal Defense Attorney | The Law Offices of Roger P. Foley, P.A.
Call (561) 746-7076 for a free 15 minute case strategy. The Law Offices of Roger P. Foley, P.A. is a Criminal Defense firm practicing in Palm Beach, Broward, and Martin Counties, and throughout Florida.

Semrush Rank: 44,651,075
Categories: Business, Business

Similar?
Yes 0 No 0

browardcriminalteam.com
Fort Lauderdale Criminal Lawyers | Meltzer & Bell, P.A.
Aggressive trial lawyers. We fight, scratch, and claw for our clients so that no matter what our clients lives aren’t changed for the worst.

Semrush Rank: 715,039 Facebook ♡: 1
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

northfloridacriminaldefense.com
Anabelle Dias P. A. Legal Defense for North Florida
The best legal defence in Tallahassee is a phone call away. Call 850.422.3427 right away. Our Tallahassee lawyers represent your cases in criminal and civil courts with thousands and court cases tried and won.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

floridadefenders.com
The Smart Choice for Criminal & DUI Defense in Florida - Your Florida Defenders
With the multitude of laws set forth by the federal government, the state government, the counties and the cities, one poor judgment call or mistake can end up with you doing time in jail and having to pay steep fines. Our Law Firm We are tenacious criminal defense attorneys that are experienced in all areas […]

Semrush Rank: 918,256
Categories: Business, Business

Similar?
Yes 0 No 0

thehoffmanfirm.net
Miami Criminal Defense Lawyer | The Hoffman Firm
Were you charged with a crime? Put decades of experience on your side by calling the Miami criminal defense lawyer at The Hoffman Firm for a free consultation.

Moz DA: 24 Moz Rank: 3.1 Semrush Rank: 665,138
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

mikeglaw.com
Criminal Defense Attorney Tampa, FL - Protect Your Rights | Mike G Law
Tampa criminal defense attorney and former prosecutor Mike G Law has over 25 years of experience protecting clients’ rights. Get your FREE consultation.

Semrush Rank: 104,652 Facebook ♡: 1,235
Categories: Computers/Software/Operating Systems, Business, Regional/North America, Business, Government and Legal Organizations

Similar?
Yes 0 No 0

jrhelpinggoodpeople.com
John P Rutkowski, Criminal Defense Attorney|
Southwest Florida Criminal Defense Attorney John Rutkowski; Call 941-888-0709 for free consultation; 27 years of experience in Criminal law, Criminal Defense, DUI, BUI, Criminal Appeals in Southwest Florida; criminal lawyer

Semrush Rank: 1,904,489 Facebook ♡: 284
Categories: Business, Business

Similar?
Yes 0 No 0

klgflorida.com
Khonsari Law Group | Criminal Defense | Family Law
The Khonsari Law Group is Florida's premiere family law and criminal defense law firm serving St Petersburg and Tampa.

Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

aullslaw.com
Brooksville Criminal Lawyer | Hernando County Defense Attorney
Ashley Aulls a criminal defense and family law attorney in Brooksville in Hernando County, Florida. Standing up for your freedom after misdemeanor or felony charges in Florida.

Semrush Rank: 3,788,502
Categories: Business, Political Organizations

Similar?
Yes 0 No 0

epllc.com
Crime and Sexual Assault Lawyer | Edwards Pottinger
Edwards Pottinger is a nationally-acclaimed, go-to law firm representing victims of violent crime and s*xual assault.

Moz DA: 25 Moz Rank: 3.2 Semrush Rank: 1,050,382 Facebook ♡: 456
Categories: Business, Business

Similar?
Yes 0 No 0

pumphreylawfirm.com
Criminal Defense Attorney | DUI Lawyers in Tallahassee | Pumphrey Law
Find experienced criminal defense and DUI lawyers in Tallahassee and Leon County, FL, at Pumphrey Law. Our lawyers fight felony, misdemeanor and DUI charges.

Semrush Rank: 218,892
Categories: Business, Business

Similar?
Yes 0 No 0

orlandocriminalteam.com
Orlando Criminal Defense Lawyer - Katz & Phillips P.A.
If you were arrested, don't assume you're out of options. Our criminal defense lawyers in Orlando will work to have your charges dropped or reduced. Call now.

Categories: Business, Violence

Similar?
Yes 0 No 0

tpatrialattorneys.com
Tampa, FL Criminal Defense | DUI Attorney | Federal Lawyer
Free consultation at Stechschulte Nell for Federal, DUI, s*x, assault, drug crime charges. Call our board certified Tampa, Florida criminal defense lawyer.

Categories: Business, Business

Similar?
Yes 0 No 0

tragoslaw.com
Clearwater Personal Injury Lawyers | Tragos, Sartes & Tragos
Clearwater personal injury lawyers are dedicated to recover financial compensation for you. Call Tragos, Sartes & Tragos, free consultation 727-441-9030.

Semrush Rank: 481,823
Categories: Business, Business

Similar?
Yes 0 No 0

jgcrimlaw.com
Orlando Criminal Defense Lawyer | Orange County DUI Attorney | Law Offices of John P. Guidry
Free Consultation - Call (407) 423-1117 - The Law Office of John Guidry aggressively represents the accused against charges in Criminal Defense & DUI cases.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

kevinkuliklaw.com
Fort Lauderdale Criminal Attorney
Fort Lauderdale criminal attorney, Kevin J. Kulik, provides aggressive defense for all federal and domestic criminal charges around Florida and the U.S.

Semrush Rank: 1,277,088 Facebook ♡: 1
Categories: Business, Advertising

Similar?
Yes 0 No 0

psffirm.com
Top Criminal Defense Attorneys in Clearwater and Tampa Bay
The best Criminal Defense attorneys in Clearwater and Tampa Bay. Experienced legal representation for criminal law.

Categories: Business, Business

Similar?
Yes 0 No 0

arnoldlawfirmllc.com
Arnold Law Firm | Florida School Attorneys
The Arnold Law Firm specializes in Charter School Law, Education Law,
Family Law, and Criminal Law.

Moz DA: 27 Moz Rank: 3.1 Facebook ♡: 4
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

rflawgroup.com
Miami Criminal Lawyer
Miami criminal lawyers, Ratzan & Faccidomo, provide aggressive representation and will act fast to protect your rights and build a strong defense.

Semrush Rank: 528,814
Categories: Business, Business

Similar?
Yes 0 No 0

thelawman.net
Orlando Criminal Defense Attorney | The Umansky Law Firm
The Orlando criminal defense attorneys at The Umansky Law Firm handle all types of criminal charges. Free case review! Call us today at 407-228-3838.

Facebook ♡: 4
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

hermanlaw.com
Nationwide Sexual Abuse Lawyer - Herman Law - Voice For Victims
Herman Law exclusively represents survivors of sex abuse. Let our sexual abuse lawyers be your voice and get you the justice you deserve.

Semrush Rank: 450,491
Categories: Politics/Opinion, Government and Legal Organizations

Similar?
Yes 0 No 0

Suggest Site to this list (floridasexcrimeattorney.com)

Please only suggest if the website is similar. We do check suggested websites carefully and only approve if it's completely similar.

Site Url

Why do you think it is similar?

Email address We'll never share your email with anyone else. You'll get a confirmation email.

3 (times) seven

I'm sure it's similar Yes

floridasexcrimeattorney.com Reviews

No reviews have been made yet.

What is sitelike.org?

sitelike.org is a free tool to search and find Similar Websites, alternatives or related to the given site.
It helps you to find similar sites based on keyword overlap and shared audience.
Our team is manually checking and finding similar websites and also our visitors are helping us to find the best similar websites.
"Similar sites like" first finds the best and top keywords for all websites and rank them.
We also use our internal algorithm with analysing the website contents and also several web sources to determine the main topics of websites which are used to find similar websites that have the closest matching set of topics. Our ranking system uses user generated content created by our team, our visitors and also our algorithm.