Similar sites like insurancetipz.com

Insurance Tips | Your best online insurance guide

Tenant user liability insurance program provides complete protection to a tenant-user who rents out premises in order to organize any sort of event or function.

Categories: Blogs/Wiki, Information Technology
Topics: get storage insurance, get tulip, insurance program, insurance tips, minnesota cities, personal damage, self storage insurance, self storage tenant insurance, storage tenant insurance, tenant user liability, tenant user liability insurance program, your best online insurance guide

Facebook ♡: 0

insurancetipz.com Reviews

Sites similar to insurancetipz.com - Top 42 insurancetipz.com alternatives

cbjfoundationsllc.com
CBJ Foundations, LLC - Concrete Foundations, Poured Concrete, Concrete Contractors
CBJ Foundations, LLC poured concrete foundations for New Homes / Additions / Barns / Garages / Storage Building and Retaining Walls.

Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

towerinsur.com
Tower Disability Income Protection, Whole, Term, And Universal Life Insurance
Tower Insurance Services Inc. is a General Insurance Agency, working primarily in the governmental market place. Services Include Prepaid Dental Plans, Disability Income Protection, Cancer Insurance, and Whole, Term and Universal Life Insurance.

Semrush Rank: 6,237,431
Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

firstpoint.co.uk
First Point Insurance - Car Insurance, Home Insurance, Business Insurance & Financial Services
High Value Car & Home Insurance, Business Insurance & Financial Services

Semrush Rank: 4,089,246
Categories: Finance/Banking, Business

Similar?
Yes 0 No 0

smartlandlordbc.ca
Welcome to smartlandlordbc.ca! Hosted by Doteasy Web Hosting Canada
Welcome page designed for Doteasy Web Hosting clients. Keep this file to be the under construction page place holder. When index.html or index.php is present in the webroot, they will be used as the default webroot index instead of this file.

Facebook ♡: 0
Categories: Real Estate, Business

Similar?
Yes 0 No 0

jml-property-insurance.co.uk
Cheap Landlord Tenant Rental property insurance and Homeowner Property insurance
Landord and Tenant Rental Property holiday home and student insurance

Categories: Finance/Banking, Business

Similar?
Yes 0 No 0

cjhouseleveling.com
CJ House Leveling
Foundation Repair and House Leveling

Semrush Rank: 3,207,240
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

gspins.com
Health Insurance Broker Bluffton, Hilton Head, Beaufort, SC - GSP Insurance Group
GSP Insurance Group #1 Independent Insurance Agency - Best Health Insurance Quotes, Health Coverage Plans in Bluffton, Hilton Head, Beaufort, South Carolina.

Categories: ,Business

Similar?
Yes 0 No 0

drickardinsurance.com
DRickard Insurance serving NY for Auto Home Business Landlord and Life Insurance
DRickard insurace sells insurance products in New York

Semrush Rank: 4,043,721
Categories: Finance/Banking, Business

Similar?
Yes 0 No 0

trustedchoice.com
Independent Insurance Agents for Home, Auto & More | Trusted Choice
Find your insurance agent online today. Since independent agents work with multiple companies they can find you the best quotes on home and auto insurance.

Semrush Rank: 14,084 Facebook ♡: 2,539
Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

lakesnwoods.com
Minnesota's Community Guide
Guide to Minnesota Communities. Government and demographic information, aerial, road and Topographic maps, area history, current and historical photos and more.

Moz DA: 45 Moz Rank: 4.2 Semrush Rank: 120,221 Facebook ♡: 3
Categories: Public Information, Reference

Similar?
Yes 0 No 0

coastali.com
Home Insurance| Gautier, MS | Coastal Insurance Associates, Ltd
Coastal Insurance Associates has been providing high-quality insurance services to all customers since 2000. Located in Gautier, MS. Call us at (228) 497-9751

Semrush Rank: 14,438,910
Categories: Business, Business

Similar?
Yes 0 No 0

firstireland.ie
Insurance Broker | First Ireland
First Ireland is one of the largest insurance brokers in Ireland, We offer great value deals on car insurance, home insurance, van insurance, travel insurance and more. Get your online insurance quote in minutes or call us on 01 882 0834 and start saving today!

Moz DA: 29 Moz Rank: 3.6 Facebook ♡: 1,550
Categories: Business, Finance and Banking

Similar?
Yes 0 No 0

altechinsurance.com

Auto, Home, and Life, and Boat Insurance in Vancouver, WA - Altech Insurance Agency

We offer a wide range of insurance options in Vancouver, WA, including Auto, Home, Life, and Boat Insurance. Call us today!

Semrush Rank: 9,481,770
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

bhinsurance.com.au

Home, Motor & Landlord Insurance | IAL

IAL (formerly Berkshire Hathaway Insurance Australia, BHIA) provides comprehensive Home, Motor & Landlord Insurance products through our preferred distribution partners, backed by Australia’s leading Insurer IAG.

Categories: Business, Finance and Banking

Similar?
Yes 0 No 0

selfstorages.com
Storage Units for Rent and Self Storage Facilities for Sale
Looking to rent a storage unit or invest in a self storage facility? We are the #1 site for buying self storage and mini storage businesses. We also have free resources for self storage operators and a huge inventory of storage rentals, including Public Storage units and cheap storage for rent.

Categories: Real Estate, Real Estate

Similar?
Yes 0 No 0

farmersofsalem.com
Farmers Of Salem :: Homeowners Insurance, Landlord Insurance, Business Insurance, Contractors Insurance, Habitational Programs
Providing real insurance solutions for real people for more than 160 years, a regional mutual insurance company specializing in insurance for Homeowners, Business Owners, Contractors and more. Serving NJ, MD, and PA

Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

storeandinsure.co.uk
Self Storage Insurance from Store and Insure
The most competitive online Self Storage Insurance provider for contents at any Storage Facility in the UK. Get an Instant Online Quote Now.

Semrush Rank: 1,437,397
Categories: Finance/Banking, Business

Similar?
Yes 0 No 0

castleinsuranceky.com
Castle Insurance, Home / Auto / Life / Commercial Insurance
Great insurance rates and coverage. Erie Insurance, Progressive Insurance, Hagerty Insurance plus many other great providers.

Semrush Rank: 4,889,216
Categories: Finance/Banking, Business

Similar?
Yes 0 No 0

justlandlords.co.uk
Just Landlords - UK Specialist Property Insurance Provider
Specialist property insurance for residential landlords in the UK. View our range of covers, obtain a quote, and take out cover online.

Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

wealthmakerfinancialservices.com.au
WealthMaker Financial Services | Wealth Creation and Management
WealthMaker Financial Services (WMFS) expert mortgage brokers & financial planners who provide clients with personalised home loan, financial and retirement planning recommendations based on their individual financial goals. Call WMFS today on 02 9233 1111.

Semrush Rank: 28,809,352
Categories: Finance/Banking, Business

Similar?
Yes 0 No 0

propertyfirstgroup.com
Property First Group Insurance Agency
Property First Group LP is a property & casualty insurance agency formed to serve the unique needs of the self storage industry.

Categories: Business, Finance and Banking

Similar?
Yes 0 No 0

smarthealthpaycard.com
SmartHealth PayCard
SmartHealth PayCard is here to help provide cardholders a revolving credit line to cover healthcare costs. Learn more today.

Semrush Rank: 2,635,568
Categories: Health, Health and Wellness

Similar?
Yes 0 No 0

quotemonkey.co.uk
Quote Monkey Home
Quote Monkey, specialist insurance for self storage, car parks, private roads, woodland and many more. Competitive quotes with buy online facility.

Semrush Rank: 8,366,395
Categories: Finance/Banking, Business

Similar?
Yes 0 No 0

minnesota-demographics.com
Minnesota Demographics - Get Current Census Data for Minnesota
Need Minnesota demographics? Get current population, race, age, income & poverty statistics for Minnesota from the US Census Bureau.

Facebook ♡: 27
Categories: Business, Reference

Similar?
Yes 0 No 0

homelet.com
HomeLet - Tenants & Landlord Insurance | Letting Agents Services
HomeLet help to take the risk out of property rental, with products to protect letting agents, tenants and landlords including landlord insurance & tenant liability insurance

Categories: Finance/Banking, Business

Similar?
Yes 0 No 0

keymaninsuranceuk.com
First Point Insurance - Car Insurance, Home Insurance, Business Insurance & Financial Services
Financial protection and assurance strategies for private clients and businesses. Free and impartial whole of market advice without obligation, call us in complete confidence.

Categories: Business

Similar?
Yes 0 No 0

smf-law.com
Stewart Melvin & Frost | Personal Injury Attorney | Defense Lawyer
One of Northeast Georgia’s top law firms, Stewart, Melvin & Frost offers a variety of legal services like civil, corporate, real estate & more. Contact us today

Moz DA: 31 Moz Rank: 3.5 Semrush Rank: 1,011,950 Facebook ♡: 12
Categories: Business, Business

Similar?
Yes 0 No 0

insurance-option.co.uk
Insurance Options and Policies - For information and services about insurance
For information and services about insurance

Facebook ♡: 0
Categories: Blogs/Wiki, Business

Similar?
Yes 0 No 0

snapnsure.net
Storage Insurance | Starting at $7.99/mo. | SnapNsure Self-Storage Insurance
SnapNsure Self-Storage insurance offers more for less! Homepage

Semrush Rank: 482,660
Categories: Marketing/Merchandising, Search Engines and Portals

Similar?
Yes 0 No 0

autopsyfiles.org
Welcome to Autopsyfiles.org - Home Page - Autopsy Reports of Celebrities and Other Famous Individuals!
Autopsyfiles.org is a website dedicated in providing autopsy reports disclosing the cause of death of famous celebrities and other infamous persons.

Semrush Rank: 480,999 Facebook ♡: 167
Categories: Society/Issues, Computers/Software/Operating Systems, Computers/Software/Internet, Sports, Violence

Similar?
Yes 0 No 0

mypandaagency.com
Panda Insurance Agency | Auto and Home Insurance | Phoenix, AZ
Shop for Arizona Auto Insurance, Home Insurance, Motorcycle Insurance, Landlord Insurance, Renters Insurance, Business Insurance and other Insurance Products.

Categories: Finance/Banking, Business

Similar?
Yes 0 No 0

tonyfranks.com
IRA, Stretch IRA, Non-Qualified Inherited IRA, 72T - Long Island, New York
Tony Franks, Antonios, Fragogiannis, Hauppauge, Islandia, Greek, Spanish, retirement, financial services representative, insurance agent, financial planner, benefits, financial, insurance, IRA, long term care insurance, disability, retirement, mutual fund, mutual funds, annuity, annuities, mortgage protection, financial planning, financial plan, financial plans, suffolk county, nassau county, long island, sales, career, education funding, college funding, 401k, savings, personal finance, financial security, business protection, key employee compensation, new home, qualified plans, non qualified plans, business planning succession, banking, income replacement, investment, income products, income replacement, retirement strategies, conservation strategies, accidental death, money market, SEP, profit sharing, money purchase plan, voluntary benefits, executive bonus plans, split dollar insurance, deferred compensation, estate tax consequences, estate planning, hauppauge, financial advisor, , marketing, 529 college plans, 529 college saving plans, 529 college savings plans, 529 education plans, 529 plans, 529 plans tax, P & C, Property and Casualty,
529 saving plans
529 savings plans
accredited buyer representative
affordable health insurance
affordable life insurance
annuities
asset management
associate in claims
associate in risk management
associates financial services
auto insurance
auto insurance agency
auto insurance claim
auto insurance co
auto insurance company
auto insurance comparison
auto insurance online
auto insurance price
auto insurance quote
auto insurance quotes
auto insurance rates
auto insurance ratings
auto insurance specialists
become a financial planner
best 529 plans
best 529 plans 2006
best life insurance
best life insurance quote
best term life insurance quote
best term life insurance quotes
business buy sell agreement
buy sell agreement
buy sell agreement contract
buy sell agreement form
buy sell agreement fo

Semrush Rank: 37,553,038
Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

accentbrokers.com
Accent Brokers Insurance
We are Accent Brokers Insurance! A family-owned insurance agency, serving families and businesses in Central Florida and the surrounding areas since 2006.

Categories: Internet Services, Information Technology

Similar?
Yes 0 No 0

accg.org
ACCG Advancing Georgia's Counties
ACCG Advancing Georgia's Counties

Facebook ♡: 25
Categories: Non-Profit/Advocacy/NGO, General Organizations

Similar?
Yes 0 No 0

realinsurance.com.au
Insurance for Car, Home, Contents, Life, Pet from Real Insurance | Real Insurance
Real Insurance has been offering more than value-for-money home, car, life & pet insurance to Australians since 2005. Contact us now!

Moz DA: 39 Moz Rank: 4.3 Semrush Rank: 846,582 Facebook ♡: 3,701
Categories: Society/Religion and Spirituality, Reference/Education, Society/Death, Finance/Banking, Business

Similar?
Yes 0 No 0

allriskinsuranceflintmi.com
Affordable Insurance | Flint, MI | All Risk Insurance
All Risk Insurance in Flint, MI is a local neighborly insurance broker who can help you shop for many types of insurance and get the best coverage for the right price. Call us at (810) 238-4055

Categories: Business, Information Technology

Similar?
Yes 0 No 0

shpc4providers.com
SmartHealth PayCard
SmartHealth PayCard is here to help provide cardholders a revolving credit line to cover healthcare costs. Learn more today.

Categories: Newly Observed Domain

Similar?
Yes 0 No 0

laptoprate.com
LaptopRate
LaptopRate.Finding the right life insurance policy.Tips to before taking life insurance.Life insurance ABC you must know.Life insurance policies types and details.Life Insurance getting it right from the start.A rear view into life insurance.Why take Accidental death and dismemberment Insurance?.Universal life insurance a quick details reviewing..A look at Limited–pay life insurance.Whole life insurance why it’s better compared to retirement benefits.

Categories: Software/Hardware, Information Technology

Similar?
Yes 0 No 0

letplan.com
letplan.com
This domain may be for sale!

Categories: Finance/Banking, Business

Similar?
Yes 0 No 0

beckins.com

Beck Insurance Agency Inc. - Beck Insurance Agency

Independent Agent serving the Fredericksburg Area and surrounding counties for their personal and commercial insurance needs.

Categories: Finance/Banking, Education

Similar?
Yes 0 No 0

pequotlakes-mn.gov
Pequot Lakes, MN
This is the official site for the City of Pequot Lakes.

Categories: Government/Military, Government and Legal Organizations

Similar?
Yes 0 No 0

storsmartinsurance.com
storsmart insurance | providers of self storage contents insurance programs
storsmart insurance is a premier provider of self storage contents insurance programs.

Categories: Finance/Banking, Business

Similar?
Yes 0 No 0

Suggest Site to this list (insurancetipz.com)

Please only suggest if the website is similar. We do check suggested websites carefully and only approve if it's completely similar.

Site Url

Why do you think it is similar?

Email address We'll never share your email with anyone else. You'll get a confirmation email.

3 (times) seven

I'm sure it's similar Yes

insurancetipz.com Reviews

No reviews have been made yet.

What is sitelike.org?

sitelike.org is a free tool to search and find Similar Websites, alternatives or related to the given site.
It helps you to find similar sites based on keyword overlap and shared audience.
Our team is manually checking and finding similar websites and also our visitors are helping us to find the best similar websites.
"Similar sites like" first finds the best and top keywords for all websites and rank them.
We also use our internal algorithm with analysing the website contents and also several web sources to determine the main topics of websites which are used to find similar websites that have the closest matching set of topics. Our ranking system uses user generated content created by our team, our visitors and also our algorithm.