Similar sites like wealthmakerfinancialservices.com.au

wealthmakerfinancialservices.com.au Edit Report

WealthMaker Financial Services | Wealth Creation and Management

WealthMaker Financial Services (WMFS) expert mortgage brokers & financial planners who provide clients with personalised home loan, financial and retirement planning recommendations based on their individual financial goals. Call WMFS today on 02 9233 1111.

Categories: Finance/Banking, Business
Topics: financial services, financial services cbd, financial services sydney, home loan, home loans, home loans sydney, wealth creation, wealth creation and management, wealth strategies, wealthmaker, wealthmaker financial services

Semrush Rank: 28,809,352

wealthmakerfinancialservices.com.au Reviews

Sites similar to wealthmakerfinancialservices.com.au - Top 37 wealthmakerfinancialservices.com.au alternatives

maycofinancialservices.com
Mayco Financial Services
financial services, investments,investment,financial planning,wealth management,insurance,group medical, benefits

Semrush Rank: 13,186,484
Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

h4fs.com
Hughes Financial Services, LLC
Hughes Financial Services, LLC

Semrush Rank: 2,569,418
Categories: Business, Finance and Banking

Similar?
Yes 0 No 0

uig-me.com
Homepage - United Insurance
Homepage - United Insurance

Moz DA: 5 Moz Rank: 1.6
Categories: Business, Finance and Banking

Similar?
Yes 0 No 0

camillerifinancial.com
Camilleri Financial Group
Camilleri Financial Group, a full service financial planning and investment advisory firm located in West Caldwell, NJ.

Moz DA: 9 Moz Rank: 2.4 Semrush Rank: 11,449,254 Facebook ♡: 0
Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

money-tree.in
money-tree.in - This website is for sale! - money tree Resources and Information.
This website is for sale! money-tree.in is your first and best source for all of the information you’re looking for. From general topics to more of what you would expect to find here, money-tree.in has it all. We hope you find what you are searching for!

Categories: Business, Business

Similar?
Yes 0 No 0

18thstreetfinancial.com
18th Street Financial Services, LLP - Private Wealth Consultants
Where Experience and Knowledge of the Financial Services Industry meet the needs of clients who desire Financial Independence and Security.

Categories: Business, Finance and Banking

Similar?
Yes 0 No 0

mattkasa.com
Orange County Financial Advisor
Matthew A. Kasa, Orange County's financial advisor and wealth manager provides highly customized financial advice, investment solutions and brokerage services to individuals, families and foundations.

Moz DA: 6 Moz Rank: 3.1 Semrush Rank: 25,408,095
Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

pmc-web.com
Professional Mortgage Connection, LLC
We are an experienced full-service mortgage lender with a vested interest in providing quality mortgage and financing services with integrity - offering you choice, value, and expertise.

Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

tfgplan.com
| Investments, Retirement, Asset Protection Planning | Sheboygan, WI | The Financial Group
The Financial Group is located in Sheboygan WI

Semrush Rank: 5,100,187
Categories: Business, Finance and Banking

Similar?
Yes 0 No 0

gregreineking.com
| Investments, Retirement, Asset Protection Planning | Sheboygan, WI | The Financial Group
The Financial Group is located in Sheboygan WI

Categories: Finance/Banking, Newly Observed Domain,Business

Similar?
Yes 0 No 0

webcource.com
WebCource
WebCource

Moz DA: 11 Moz Rank: 3.8 Semrush Rank: 10,457,207 Facebook ♡: 631
Categories: Science/Social Sciences, Reference/Education, Blogs/Wiki, Reference

Similar?
Yes 0 No 0

johnhowells.com
John F. Howells, CLU, ChFC, CFP
John Howells has 25 years of experience providing financial strategies, products and services including life insurance, annuities and investments, college, estate, retirement and business planning. He offers personal financial public workshops in the Northern San Diego area and continuing education courses for CPAs.

Semrush Rank: 5,315,482
Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

pricefinancial.us
Price Financial Services - Equitable Advisors
Financial Planner, Equitable, EQUITABLE-ADVISOR, EQUITABLE-ADVISORS, CFP, Certified Financial Planner, Financial Advisor, Mutual Funds, Insurance, Financial Professional, Investments, Cynthia Price, CIndy Price, Price Financial Services, Financial Services, Orlando Financial Planners, Florida Financial Planners, Find a Financial Planner, MONY, Mutual of New York, Adviser, Financial planning, Financial advisor, Advice, Success, Goals, Trust, Asset Management, Retirement, Retirement planning, Investments, Investment planning, Investment managers, Portfolio, Insurance, Annuities, Education funding, College funding, Estate planning, Asset allocation, Mutual funds, Asset Management, Asset Management Account, Asset Allocation, Brokerage, Broker, Wealth Protection, Wealth, 401k, 401(k), 403b, 403(b), 529 Plans, SEP, Online financial tools, Calculators, News, Financial Articles, Stock Quotes, Advice and Services, IRA, Roth IRA, Tax Sheltered Annuities, TSA, Trusts, Life Insurance, Variable Life Insurance, Variable annuities, Fixed Annuities, Estate Planning, Executive Benefits, COLI, Corporate Owned Life Insurance, Capital, Building Futures, Your Future Your Way, MONY.com

Semrush Rank: 14,940,123
Categories: Finance/Banking, Business

Similar?
Yes 0 No 0

sauserfinancial.com
Sauser Financial, LLC - Integrated Strategies. Comprehensive Solutions.
Sauser Financial, LLC is a leading provider of integrated, objective financial planning and investment management solutions.

Semrush Rank: 17,156,086
Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

packard-financial.com
Packard Financial & Insurance Services
Chris Packard helps you make smart financial decisions to save time, save money and simplify your life!

Semrush Rank: 11,341,420
Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

jvbfinancial.net
Jay Van Beusekom Financial Advisor, LLC.
Jay Van Beusekom, RHU LUTCF President & CEO of Jay Van Beusekom Financial Advisor, LLC.
Helping to Take the Confusion out of Retirement.
Serving the Southeastern Wisconsin area for over 29 years.

Categories: Finance/Banking, Business

Similar?
Yes 0 No 0

financialcapitalgroup.com
Financial Capital Group, LLC
Financial Capital Group LLC, Financial Capital Group, Financial, Capital, Group, Eric Ciarelli, Eric, Mark Ciarelli, Mark, Ciarelli, 1930 Route 70 East Suite G37 Cherry Hill NJ 08003, 856-874-1515, Executive Mews, [email protected], [email protected], [email protected], for securities: [email protected] and [email protected]; Cherry Hill, South Jersey, Philadelphia, Philadelphia Area, Investments, Investment Planning, Investment Suggestions, Investment Solutions, Investment Ideas, Stocks, Bonds, Mutual Funds, REITS, Real Estate Investment Trusts, Exchange Traded Funds, ETF, Stock Portfolio, Bond Portfolio, Mutual Fund Portfolio, Exchange Traded Fund Portfolio, Diversified Portfolio, Diversification, Value Investing, Growth Investing, Income Planning, Growth, Growth and Income, Aggressive Growth, Moderate Growth, Conservative, Conservative Investor, Moderate, Moderate Investor, Aggressive, Aggressive Investor, Speculative Investor, Speculative, IRA, SEP IRA, SIMPLE IRA, Roth IRA, 401(k) Roth 401(k), Defined Benefit, Defined Benefit Plan, Defined Contribution Plan, Defined Contribution, Retirement Planning, Retirement, Qualified Plan, Qualified Plan Selection, Qualified Plan Options, Qualified Plan Choices, Funding Retirement, Retirement Concerns, Retirement Funding, Retirement Options, Retirement Questions, IRA Rollover, Rollover IRA, Nest Egg, Individual Account, Individual Investment Account, Joint Account, Joint Investment Account, Trust Account, Trust Investment Account, College Planning, Planning for College, 529, 529 Plan, 529 College Plan, 529 College Account, 529 College Savings Plan, 529 Investment Account, UTMA, UTMA Account, Portfolio, Portfolio Design, Diversified Portfolio, Investor Concerns, Investor Questionnaire, Investor Profile, CFP, Certified Financial Planner, Insurance Agent, Stock Broker, Financial Advisor, Financial Adviser, Financial Consultant, Successful Investing, Income, Stock Market Performance, Investment Accou

Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

estateplansandprobate.com
Estate Plans and Probate :: Estate Planning, Probate Law, Real Estate Law
Estate Plans and Probate - Estate Planning, Probate Law and Real Estate Law

Moz DA: 3 Moz Rank: 1.9 Facebook ♡: 0
Categories: Business, Business

Similar?
Yes 0 No 0

partnersinplanning.financial
Partners in Planning LLC
Partners in Planning LLC

Semrush Rank: 10,308,961
Categories: Finance/Banking, Business

Similar?
Yes 0 No 0

noffsingerfinancial.com
Noffsinger Financial Group
Noffsinger Financial Group are independent financial advisors offering expert investment advice while serving the financial planning needs of Newport News.

Semrush Rank: 43,656,807
Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

wealthatm.com
Wealth ATM
Wealth ATM

Categories: Business

Similar?
Yes 0 No 0

josephsilvestri.com
Joseph P. Silvestri CFP®, CHFC®, CASL®, CLTC®
Joseph Silvestri CFP®, ChFC, CASL, CLTC, Certified Financial Planner

Semrush Rank: 6,696,034
Categories: Business, Business

Similar?
Yes 0 No 0

embassyfinancialgroup.com
Embassy Financial Group,Inc..
Embassy Financial Group,Inc..

Moz DA: 22 Moz Rank: 3.2 Semrush Rank: 25,668,966
Categories: Real Estate, Real Estate

Similar?
Yes 0 No 0

kredentmoney.com
Kredent Money - Complete solution for Financial Planning
Kredent Money is the simple and automated service to find the best paperless financial advise. Kredent Money is an analytical platform with behavioural analysis using artificial intelligence and high data for unbiased and automated financial and investment strategies. Lets live a smart and wealthy life.

Categories: Finance/Banking, Business

Similar?
Yes 0 No 0

uat-tomorrowmakers.com
Let's get smarter about money | Tomorrowmakers
Tomorrow Makers is your one-stop destination for everything to do with money management, tax planning, investment, insurance, and the ever-changing world of personal finance.

Categories: Finance/Banking, Business

Similar?
Yes 0 No 0

honestfinancialplanners.com
John R. Pearson, CFP®
John R. Pearson, CFP® is a Certified Financial Planner in Santa Rosa, California that specializes in fee-based asset management, retirement and financial planning since 1986.

Semrush Rank: 28,664,771
Categories: Finance/Banking, Business

Similar?
Yes 0 No 0

retirement911.com
Louis Feldman, CFP®, JD, CPA/PFS
Louis Feldman, CFP®, JD, CPA/PFS

Moz DA: 8 Moz Rank: 2.7 Semrush Rank: 23,105,656 Facebook ♡: 0
Categories: Finance/Banking, Business

Similar?
Yes 0 No 0

lacarex.com

Moz DA: 1 Moz Rank: 2 Facebook ♡: 0
Categories: Motor Vehicles, Business

Similar?
Yes 0 No 0

visionwealthstrategies.com
Vision Wealth Strategies
This Web site is designed to help our clients achieve their financial goals through a long-term relationship with a trusted and knowledgeable advisor.

Semrush Rank: 12,417,499
Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

myprovidencefs.com
Providence Financial Solutions
Here at Providence, we design financial solutions for our clients to help meet their individual or family goals based on their unique situation. We believe having a strong financial plan is paramount in meeting one’s life goals whether they consist of having a comfortable retirement, sending your kids to college, starting a business, buying your first home, or protecting your loved ones in case of the unexpected.

Semrush Rank: 7,487,868
Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

ukinsurances.com
Insurance, Car Insurance, Travel Insurance, House Insurance, Life Insurance, Health Insurance, from Independent Financial Advisers
insurance uk insurance life insurance uk life insurance house insurance uk house insurance car insurance uk car insurance travel insurance uk travel insurance health insurance uk health insurance medical insurance uk medical insurance critical illness cover mortgage protection uk mortgage protection redundancy cover redundancy insurance mortgage redundancy accident and sickness cover whole of life term insurance family income benefit permanent health insurance loan protector commercial insurance shop insurance

Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

adfinancing.com
AmericanDreamFinancing.com : Home

Categories: Finance/Banking, Business

Similar?
Yes 0 No 0

assuredhomeloans.com.au
Home Loans Adelaide - Assured Home Loans for Buyers & Investors
Find a home loan that's right for you. Talk to a home loan expert in Adelaide today, compare home loans & calculate repayments with Assured Home Loans.

Semrush Rank: 6,542,503 Facebook ♡: 2,038
Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

advisoryfs.com
Advisory Financial Services, Orange County, California
ADVISORY FINANCIAL SERVICES provides comprehensive financial planning, tax preparation and investment services site, located in coastal orange county Dana Point California area, Monarch Beach, CA

Semrush Rank: 9,441,301
Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

personalloans.co.uk
personalloans.co.uk
personalloans.co.uk

Moz DA: 4 Moz Rank: 1.6 Facebook ♡: 0
Categories: Online Shopping, Finance and Banking

Similar?
Yes 0 No 0

androida1jamali.blogspot.com
اندرويد الجمالي
اندرويد الجمالي مدونة متخصص تعريب وفك شفرات وتخطي حساب جوجل وفك شفرات ملتقي المطورين العرب والاجانب في تطوير البرامج والتطبيقات وتعريب وفك شفرة وتخطي جوجل والعاب جديدة وتطبيقات متنوعة

Facebook ♡: 84
Categories: Blogs/Wiki, Personal Websites and Blogs

Similar?
Yes 0 No 0

eaglesolutionsonline.com

Semrush Rank: 10,093,076
Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

Suggest Site to this list (wealthmakerfinancialservices.com.au)

Please only suggest if the website is similar. We do check suggested websites carefully and only approve if it's completely similar.

Site Url

Why do you think it is similar?

Email address We'll never share your email with anyone else. You'll get a confirmation email.

3 (times) seven

I'm sure it's similar Yes

wealthmakerfinancialservices.com.au Reviews

No reviews have been made yet.

What is sitelike.org?

sitelike.org is a free tool to search and find Similar Websites, alternatives or related to the given site.
It helps you to find similar sites based on keyword overlap and shared audience.
Our team is manually checking and finding similar websites and also our visitors are helping us to find the best similar websites.
"Similar sites like" first finds the best and top keywords for all websites and rank them.
We also use our internal algorithm with analysing the website contents and also several web sources to determine the main topics of websites which are used to find similar websites that have the closest matching set of topics. Our ranking system uses user generated content created by our team, our visitors and also our algorithm.