Similar sites like money-tree.in

money-tree.in - This website is for sale! - money tree Resources and Information.

This website is for sale! money-tree.in is your first and best source for all of the information you’re looking for. From general topics to more of what you would expect to find here, money-tree.in has it all. We hope you find what you are searching for!

Categories: Business, Business
Topics: borrowing, financial planning, financial services, investments, money tree, moneytree, mutual funds, nri, tax planning, wealth creation simplified, www.money-tree.in

money-tree.in Reviews

Sites similar to money-tree.in - Top 36 money-tree.in alternatives

theadvicecenter.com
Tom Wood, Investment Advisor, Wealth Management, Annuities Redding, CA www.theadvicecenter.com
Tom Wood, Investment Advisor, Wealth Management, Annuities Redding, CA www.theadvicecenter.com

Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

maycofinancialservices.com
Mayco Financial Services
financial services, investments,investment,financial planning,wealth management,insurance,group medical, benefits

Semrush Rank: 13,186,484
Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

cdfsfinancialstrategies.com
CDFS Financial Strategies - Kelly Christensen - Mathew Driscoll, CFP®
CDFS Financial Strategies Kelly Christensen & Mathew Driscoll, CFP. Financial Strategies and Solutions.

Categories: Finance/Banking, Business

Similar?
Yes 0 No 0

mattkasa.com
Orange County Financial Advisor
Matthew A. Kasa, Orange County's financial advisor and wealth manager provides highly customized financial advice, investment solutions and brokerage services to individuals, families and foundations.

Moz DA: 6 Moz Rank: 3.1 Semrush Rank: 25,408,095
Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

crystalclearfinancialgroup.com
Crystal Clear Financial Group LLC
Crystal Clear Financial Group LLC

Semrush Rank: 11,101,511
Categories: Finance/Banking, Business

Similar?
Yes 0 No 0

freedomfinancialonline.com
Freedom Financial
Investments, investment accounts, investment planning, financial services, IRA, 401k, mutual funds, fixed annuity, retirement, financial panning, insurance, life insurance, health insurance, disability insurance, long term care insurance.

Semrush Rank: 6,421,287
Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

tfgplan.com
| Investments, Retirement, Asset Protection Planning | Sheboygan, WI | The Financial Group
The Financial Group is located in Sheboygan WI

Semrush Rank: 5,100,187
Categories: Business, Finance and Banking

Similar?
Yes 0 No 0

gregreineking.com
| Investments, Retirement, Asset Protection Planning | Sheboygan, WI | The Financial Group
The Financial Group is located in Sheboygan WI

Categories: Finance/Banking, Newly Observed Domain,Business

Similar?
Yes 0 No 0

nm-cpa.com
Nelson & McKay CPAs, LLC
Nelson & McKay CPA’s, LLC is an integrated tax and financial services firm that helps you understand the tax implications of your investment choices and ensure you are making the right decisions to help you achieve your financial goals.

Semrush Rank: 25,566,489
Categories: Business, Business

Similar?
Yes 0 No 0

pricefinancial.us
Price Financial Services - Equitable Advisors
Financial Planner, Equitable, EQUITABLE-ADVISOR, EQUITABLE-ADVISORS, CFP, Certified Financial Planner, Financial Advisor, Mutual Funds, Insurance, Financial Professional, Investments, Cynthia Price, CIndy Price, Price Financial Services, Financial Services, Orlando Financial Planners, Florida Financial Planners, Find a Financial Planner, MONY, Mutual of New York, Adviser, Financial planning, Financial advisor, Advice, Success, Goals, Trust, Asset Management, Retirement, Retirement planning, Investments, Investment planning, Investment managers, Portfolio, Insurance, Annuities, Education funding, College funding, Estate planning, Asset allocation, Mutual funds, Asset Management, Asset Management Account, Asset Allocation, Brokerage, Broker, Wealth Protection, Wealth, 401k, 401(k), 403b, 403(b), 529 Plans, SEP, Online financial tools, Calculators, News, Financial Articles, Stock Quotes, Advice and Services, IRA, Roth IRA, Tax Sheltered Annuities, TSA, Trusts, Life Insurance, Variable Life Insurance, Variable annuities, Fixed Annuities, Estate Planning, Executive Benefits, COLI, Corporate Owned Life Insurance, Capital, Building Futures, Your Future Your Way, MONY.com

Semrush Rank: 14,940,123
Categories: Finance/Banking, Business

Similar?
Yes 0 No 0

sauserfinancial.com
Sauser Financial, LLC - Integrated Strategies. Comprehensive Solutions.
Sauser Financial, LLC is a leading provider of integrated, objective financial planning and investment management solutions.

Semrush Rank: 17,156,086
Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

packard-financial.com
Packard Financial & Insurance Services
Chris Packard helps you make smart financial decisions to save time, save money and simplify your life!

Semrush Rank: 11,341,420
Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

principalfg.com
CDFS Financial Strategies - Kelly Christensen - Mathew Driscoll, CFP®
CDFS Financial Strategies Kelly Christensen & Mathew Driscoll, CFP. Financial Strategies and Solutions.

Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

nesteggadvisors.net
NestEgg Advisors, Inc.
long island financial planners, long island financial advisors, investment management, retirement planning, Bud Levy, Certified Financial Planner, fee-based investment advice,

Semrush Rank: 5,006,655
Categories: Business, ,Finance and Banking

Similar?
Yes 0 No 0

financialcapitalgroup.com
Financial Capital Group, LLC
Financial Capital Group LLC, Financial Capital Group, Financial, Capital, Group, Eric Ciarelli, Eric, Mark Ciarelli, Mark, Ciarelli, 1930 Route 70 East Suite G37 Cherry Hill NJ 08003, 856-874-1515, Executive Mews, [email protected], [email protected], [email protected], for securities: [email protected] and [email protected]; Cherry Hill, South Jersey, Philadelphia, Philadelphia Area, Investments, Investment Planning, Investment Suggestions, Investment Solutions, Investment Ideas, Stocks, Bonds, Mutual Funds, REITS, Real Estate Investment Trusts, Exchange Traded Funds, ETF, Stock Portfolio, Bond Portfolio, Mutual Fund Portfolio, Exchange Traded Fund Portfolio, Diversified Portfolio, Diversification, Value Investing, Growth Investing, Income Planning, Growth, Growth and Income, Aggressive Growth, Moderate Growth, Conservative, Conservative Investor, Moderate, Moderate Investor, Aggressive, Aggressive Investor, Speculative Investor, Speculative, IRA, SEP IRA, SIMPLE IRA, Roth IRA, 401(k) Roth 401(k), Defined Benefit, Defined Benefit Plan, Defined Contribution Plan, Defined Contribution, Retirement Planning, Retirement, Qualified Plan, Qualified Plan Selection, Qualified Plan Options, Qualified Plan Choices, Funding Retirement, Retirement Concerns, Retirement Funding, Retirement Options, Retirement Questions, IRA Rollover, Rollover IRA, Nest Egg, Individual Account, Individual Investment Account, Joint Account, Joint Investment Account, Trust Account, Trust Investment Account, College Planning, Planning for College, 529, 529 Plan, 529 College Plan, 529 College Account, 529 College Savings Plan, 529 Investment Account, UTMA, UTMA Account, Portfolio, Portfolio Design, Diversified Portfolio, Investor Concerns, Investor Questionnaire, Investor Profile, CFP, Certified Financial Planner, Insurance Agent, Stock Broker, Financial Advisor, Financial Adviser, Financial Consultant, Successful Investing, Income, Stock Market Performance, Investment Accou

Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

estateplansandprobate.com
Estate Plans and Probate :: Estate Planning, Probate Law, Real Estate Law
Estate Plans and Probate - Estate Planning, Probate Law and Real Estate Law

Moz DA: 3 Moz Rank: 1.9 Facebook ♡: 0
Categories: Business, Business

Similar?
Yes 0 No 0

partnersinplanning.financial
Partners in Planning LLC
Partners in Planning LLC

Semrush Rank: 10,308,961
Categories: Finance/Banking, Business

Similar?
Yes 0 No 0

wealthmakerfinancialservices.com.au
WealthMaker Financial Services | Wealth Creation and Management
WealthMaker Financial Services (WMFS) expert mortgage brokers & financial planners who provide clients with personalised home loan, financial and retirement planning recommendations based on their individual financial goals. Call WMFS today on 02 9233 1111.

Semrush Rank: 28,809,352
Categories: Finance/Banking, Business

Similar?
Yes 0 No 0

capecodwealth.com
Cape Cod's certified financial planner & wealth management company | Cape Cod Wealth Strategies & Insurance Services, LLC
Certified financial planner on Cape Cod providing 401k advice, pension maximization, fixed annuities, life & disability insurance, business & estate continuation funding.

Semrush Rank: 10,667,963
Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

nicoriverso.com
Integrated Financial Concepts
Financial Planning is for people who wish to establish a direction for their financial lives, coordinate the actions taken across a broad spectrum of financial arenas and then periodically make adjustments to help them towards their goals and objectives. My clients receive the benefits of my years of practical business experience, personal, caring service and commitment to providing the latest financial and economic information to help them in today’s changing environment.

Semrush Rank: 2,816,739
Categories: Business, Finance and Banking

Similar?
Yes 0 No 0

evergreenwealthmanagement.com
Evergreen Wealth Management LLC
Evergreen Wealth Management LLC provides quotes and information for life insurance, Retirement planning, stocks, bonds, etfs, Alternative Investments, Mutual funds, Structured Settlements, Annuities, Long term care, disability, health insurance, and Medicare supplements. Business planning in developing buy sell arrangements using, stock options, life insurance, keyperson insurance, 401ks, Simple IRA, SEPS, solo 401K, IRA, Non Qualified Deffered Compensation plans, and Self Insurance health plans. Estate Planning using Charities, and providing strategies for Generational planning. Tax planning in using tax deffered investments or tax favorable investments, or 401K or IRA's.

Moz DA: 11 Moz Rank: 2.7 Semrush Rank: 7,358,515 Facebook ♡: 7
Categories: Business, Finance and Banking

Similar?
Yes 0 No 0

midamsecurities.com
MidAmerica Securities Management Co

var gaJsHost = ((https: == document.location.protocol) ? https://ssl. : http://www.);
document.write(unescape(%3Cscript src=' + gaJsHost + google-analytics.com/ga.js' type='text/javascript'%3E%3C/script%3E));

var pageTracker = _gat._getTracker(UA-5445766-2);
pageTracker._trackPageview();

We help you build and preserve wealth. Once your goals have been established, we customize appropriate strategies to suit your vision and objectives. We help you execute a sound financial program. Call us today!

Semrush Rank: 12,113,670
Categories: Business, Finance and Banking

Similar?
Yes 0 No 0

kredentmoney.com
Kredent Money - Complete solution for Financial Planning
Kredent Money is the simple and automated service to find the best paperless financial advise. Kredent Money is an analytical platform with behavioural analysis using artificial intelligence and high data for unbiased and automated financial and investment strategies. Lets live a smart and wealthy life.

Categories: Finance/Banking, Business

Similar?
Yes 0 No 0

uat-tomorrowmakers.com
Let's get smarter about money | Tomorrowmakers
Tomorrow Makers is your one-stop destination for everything to do with money management, tax planning, investment, insurance, and the ever-changing world of personal finance.

Categories: Finance/Banking, Business

Similar?
Yes 0 No 0

tallieoyoung.com
Tallie O. Young & Associates
Tallie O. Young & Associates was formed as a mentoring organization to provide financial education and guidance to clients, their families and their businesses.

Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

consumerinsuranceadvocates.com
Consumer Insurance Advocates
Consumer Insurance Advocates is your one stop for all of your personal and business insurance needs. We offer simple solutions and uncommon service.

Semrush Rank: 15,518,985
Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

gofinance.ca
The domain name GoFinance.ca is for sale
The domain name GoFinance.ca is for sale. Make an offer or buy it now at a set price.

Facebook ♡: 3
Categories: Business, Finance and Banking

Similar?
Yes 0 No 0

kmcapitalmgt.com
KM Capital Management
KM Capital Management is a leading private wealth management firm that provides comprehensive financial services to high net-worth professional athletes and entertainers.

Semrush Rank: 3,902,346
Categories: Business, Finance and Banking

Similar?
Yes 0 No 0

houstonfinancialcenter.com
HOUSTON FINANCIAL CENTER
HOUSTON FINANCIAL CENTER

Semrush Rank: 3,521,172
Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

gpsfinancialsc.com
GPS Financial Strategies, LLC
GPS Financial Strategies, LLC

Semrush Rank: 38,195,419
Categories: Business

Similar?
Yes 0 No 0

westcofinancialgroup.com
Westco Financial Group
Westco Financial Group
77 Hempstead Avenue
Lynbrook, NY 11563
(516) 593-5070

This Web site is designed to help our friends and clients achieve their financial goals through a long-term relationship with trusted and knowledgeable advisors.

Semrush Rank: 7,311,583
Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

advisoryfs.com
Advisory Financial Services, Orange County, California
ADVISORY FINANCIAL SERVICES provides comprehensive financial planning, tax preparation and investment services site, located in coastal orange county Dana Point California area, Monarch Beach, CA

Semrush Rank: 9,441,301
Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

ascensionfinancialgroup.com
Ascension Financial Group, Inc.
Individuals and Businesses entrust their Financial Planing to Ascension Financial Group Inc. because they receive experienced counsel which results in clear goals and personalized strategies.

Semrush Rank: 10,641,925
Categories: Business, Finance and Banking

Similar?
Yes 0 No 0

clearcreekinvestments.com
Clear Creek Investment Services
Clear Creek Investment Services

Semrush Rank: 23,672,705
Categories: Internet Services, Finance and Banking

Similar?
Yes 0 No 0

kfsonline.net
Keystone Financial Services
Independent Investment and Insurance Consultants. Helping local individuals and business owners with their financial planning needs.

Semrush Rank: 3,699,025
Categories: Finance/Banking,

Similar?
Yes 0 No 0

eaglesolutionsonline.com

Semrush Rank: 10,093,076
Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

Suggest Site to this list (money-tree.in)

Please only suggest if the website is similar. We do check suggested websites carefully and only approve if it's completely similar.

Site Url

Why do you think it is similar?

Email address We'll never share your email with anyone else. You'll get a confirmation email.

3 (times) seven

I'm sure it's similar Yes

money-tree.in Reviews

No reviews have been made yet.

What is sitelike.org?

sitelike.org is a free tool to search and find Similar Websites, alternatives or related to the given site.
It helps you to find similar sites based on keyword overlap and shared audience.
Our team is manually checking and finding similar websites and also our visitors are helping us to find the best similar websites.
"Similar sites like" first finds the best and top keywords for all websites and rank them.
We also use our internal algorithm with analysing the website contents and also several web sources to determine the main topics of websites which are used to find similar websites that have the closest matching set of topics. Our ranking system uses user generated content created by our team, our visitors and also our algorithm.