Similar sites like matassinilaw.com

Tampa Car Accident Lawyer

The Tampa car accident lawyers at Matassini Law Firm, P.A. help clients who have been injured in car, truck & motorcycle accidents, call for a free consultation.

Categories: Marketing/Merchandising, Government and Legal Organizations
Topics: tampa car accident lawyer

Semrush Rank: 2,304,416

matassinilaw.com Reviews

Sites similar to matassinilaw.com - Top 75 matassinilaw.com alternatives

tampainjuryaccidentlaw.com
Tampa Injury Lawyer
Our Tampa injury lawyers care about our clients, care about justice, and care about obtaining fair and adequate compensation for the harm done to you.

Categories: Business, Business

Similar?
Yes 0 No 0

thefernandezlawgroup.com
Fernandez Law Group: Tampa Lawyers & Attorneys at Law
Fernandez Law Group Tampa Lawyers & Attorneys at Law: Personal Injury, Criminal Defense, DUI & Traffic Violations. FREE Consultations. 813-489-3222

Semrush Rank: 1,455,969
Categories: Business, Political Organizations

Similar?
Yes 0 No 0

mtlawcenter.com
Tampa Personal Injury Lawyer | Tampa Injury Firm
Contact a Tampa personal injury lawyer at Mandelbaum Trichler Law Center, P.A if you have been injured or lost a loved one for a free consultation.

Moz DA: 20 Moz Rank: 2.8 Semrush Rank: 9,881,778 Facebook ♡: 266
Categories: Business, Business

Similar?
Yes 0 No 0

larsonjohnsonlaw.com
Tampa Injury Lawyers, Accident Attorneys, Car Accident
Each Tampa injury lawyers at Larson Johnson, P.L. are skilled in representing victims of accidents, as well as families who have suffered a wrongful death in Florida.

Semrush Rank: 9,617,995
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

hunterlawgroup.com
Tampa Florida Personal Injury and Family Law Attorneys | Hunter Law
Tampa Florida Personal Injury and Family Law Attorneys | Hunter Law

Moz DA: 27 Moz Rank: 3.8 Semrush Rank: 619,667
Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

ckfirm.com
Tampa Personal Injury Lawyers, Car Accident Attorneys
Get the personal injury representation you deserve. Call 813-217-5647 for a free consultation with the Tampa attorneys of Culpepper Kurland. We fight for you.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

fernandezfirm.com
Tampa Personal Injury Attorneys - The Fernandez Firm
Our Tampa personal injury attorneys have won over $90 Million dollars for injury victims in auto accidents, medical malpractice and all serious injuries.

Moz DA: 31 Moz Rank: 3.6 Semrush Rank: 436,577 Facebook ♡: 0
Categories: Sports, Business

Similar?
Yes 0 No 0

capazlaw.com
Personal Injury Attorney & Car Accident Lawyer in Tampa FL - Capaz Law Firm
Capaz Law Firm is a full-service Tampa personal injury law firm committed to providing individual attention and working hard to achieve our clients' goals.

Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

wintersandyonker.com
Tampa Personal Injury Lawyers | Winters & Yonker
Have you been injured due to someone else's negligence in Tampa or in the state of Florida? Call our Personal Injury Lawyers for a【 FREE CONSULTATION 】

Moz DA: 33 Moz Rank: 3.9 Semrush Rank: 253,625
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

yourtampalawyer.com
Tampa Criminal Attorney | FL Criminal Lawyer | Caimano Law Firm P.A.
When you need a Tampa criminal attorney, Caimano Law Firm, P.A. is the right place to call for quality representation.

Semrush Rank: 5,006,157
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

franchilaw.com
Personal Injury Lawyer in Tampa FL, Best Accident Lawyer
Franchi Injury Law is a personal injury firm in Tampa. Our personal injury lawyer provides best accident lawyer to help you recover compensation.

Categories: Business, Business

Similar?
Yes 0 No 0

spinnerlawfirm.com
Spinner Law Firm - Personal Injury Attorneys Wesley Chapel - Best Personal Injury Lawyers Wesley Chapel
For over 20 years, Spinner Law Firm is the trusted choice for victims of accidents resulting in serious injury, or death. Charles Spinner and his team have a proven track record of recovering maximum compensation for their injured clients. They are highly regarded for their tenacity, skill, and meticulous preparation and they have recovered millions of dollars in verdicts and settlements for their clients.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

shraderlawfirm.com
Top Tampa Criminal Defense Attorney - Shrader Mendez & O'Connell in Tampa, Florida
Hillsborough County criminal defense lawwyers in Tampa, Florida, providing top representation for those wrongly accused of crimes in Florida.

Semrush Rank: 3,320,465
Categories: Business, Business

Similar?
Yes 0 No 0

armandoinjurylaw.com
Personal Injury Lawyer | Tampa, Florida Attorney | Armando Personal Injury Law
Injured in a crash and need help getting compensation? Tampa car accident lawyer Armando Edmiston knows how to get real results. Contact our law firm today.

Semrush Rank: 3,337,112
Categories: Business, Business

Similar?
Yes 0 No 0

cdbinjurylaw.com
Home - CDB Injury Law- Tampa Personal Injury Law Firm
If you or a loved one have been injured due to the negligence or carelessness of another, you may find yourself overwhelmed with medical expenses, lost wages,

Semrush Rank: 10,178,568
Categories: Business, Business

Similar?
Yes 0 No 0

tgalaw.com
Tampa Auto Accident Lawyer
Tampa auto accident lawyers Anderson & Anderson handle car, truck & motorcycle accidents, personal injury, slip & fall, medical malpractice & more.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

smithstallworth.com
Tampa Personal Injury Attorney | Smith & Stallworth
Injured? Contact a Tampa personal injury lawyer at Smith & Stallworth, Attorneys at Law 24/7 to arrange a FREE consultation. You don’t pay unless we win!

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

kfblaw.com
Florida Personal Injury Attorneys | Kinney, Fernandez & Boire
Our experienced Florida personal injury attorneys will resolve your accident case with integrity & compassion. Contact us today for a FREE case evaluation.

Moz DA: 32 Moz Rank: 4.3 Semrush Rank: 793,334 Facebook ♡: 0
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

cataniaandcatania.com
Tampa Personal Injury Lawyer - Catania and Catania Injury Lawyers
Catania & Catania Injury Lawyers has 120+ years of combined experience helping accident victims. Call our Tampa personal injury lawyers today for a free consultation.

Moz DA: 29 Moz Rank: 3.7 Semrush Rank: 189,059
Categories: Business, Business

Similar?
Yes 0 No 0

thefloridalawgroup.com
Florida Car Accident Lawyers | The Florida Law Group
The Florida Law Group is a nationally-recognized law firm specializing in personal injury, car accident, truck accident and motorcycle accident claims. If you have been in an accident or injured in the Tampa, Florida area, please contact our personal injury attorneys for a free consultation.

Semrush Rank: 718,300
Categories: Business, Business

Similar?
Yes 0 No 0

accidenttampa.com
The Law Offices of Michael R. Herron, P.A. | Tampa Personal Injury Lawyer
Looking for Personal Injury Lawyers Or Firms In Tampa? I’m an attorney located in Tampa but I serve clients nationwide. NO FEES if I don’t win your case!

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

escobarlaw.com
Criminal Defense Attorney Tampa, FL | DUI Defense
Call the experienced Tampa, Florida, criminal defense attorneys at Escobar, Michaels & Associates at 813-513-0274 for a free consultation.

Categories: Business, Web Hosting

Similar?
Yes 0 No 0

Similar?
Yes 0 No 0

employmentlawtampa.com
Sass Law Firm | Tampa Employment Lawyers
Experienced | Passionate | Tenacious - With over 25 years of experience representing employees in workplace disputes, Sass Law Firm ranks as a Best Law Firm in Employment Law for Individuals by U.S. News & World Report. Whether you are seeking legal representation or need more information about your employment law rights regarding discrimination, retaliation, wrongful termination, contracts, unpaid wages or whistleblowing, the attorneys at Sass Law Firm can help.

Semrush Rank: 955,807
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

joevinjurylaw.com
Personal Injury Attorney Tampa Florida | Auto Accident Lawyer Tampa
Tampa Personal Injury Lawyer, Joseph Vecchioli, works aggressively to get our clients the compensation they deserve. Call (813) 930-5532.

Semrush Rank: 35,918,841
Categories: Business, Business

Similar?
Yes 0 No 0

rhinolawyers.com
🦏 Auto Accident Lawyers | RHINO Lawyers | Injured or Arrested?
Injured in an auto accident or arrested? Partner with RHINO Lawyers today and we promise you will never be just another case.

Semrush Rank: 466,187
Categories: Business, Business

Similar?
Yes 0 No 0

suarezlawfirm.com
Ed Suarez : Tampa's Top White Collar Criminal Defense Attorney
In a world full of lawyers, you will rarely find trial attorneys as capable, approachable, and committed to their clients as Ed Suarez and Rachel May Zysk. Our attorneys have successfully represented clients in state and federal courts throughout Florida and elsewhere.

Semrush Rank: 3,709,864
Categories: Business, Business

Similar?
Yes 0 No 0

bullucklawgroup.com
Personal Injury Law Firm Tampa | Personal Injury Attorneys
Bulluck Law Group specializes in personal injury. Our attorneys are among the top personal injury lawyers in Tampa & surrounding areas. 📞 us for FREE consultation!

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

sessumslawgroup.com
Tampa & Sarasota Law Firm | Sessums Law Group, P.A.
Sessums Law Group, PA represents Tampa and Sarasota area clients in personal injury, auto accident, family law, divorce and business matters.

Semrush Rank: 2,706,102
Categories: Business, Business

Similar?
Yes 0 No 0

lopezlawpa.com
Tampa Personal Injury Lawyer - Injury Attorney Florida | Dennis A. Lopez
Tampa Personal Injury Lawyer at Dennis A. Lopez & Associates will fight to get you the compensation you deserve after your personal injury.

Semrush Rank: 9,541,786
Categories: Business, Business

Similar?
Yes 0 No 0

prughlaw.com
Tampa Personal Injury Attorney | St. Petersburg Wrongful Death Lawyer
Serious accident in the Tampa-St. Petersburg area? Call 813-251-3548 to consult a trial-proven personal injury attorney at Prugh & Associates, P.A.

Semrush Rank: 4,453,349
Categories: Business, Health and Wellness

Similar?
Yes 0 No 0

jeffmurphylaw.com
Personal Injury Attorney Tampa, FL - Auto Accident Lawyer Tampa Florida
Experienced lawyer who provides effective and aggressive representation in cases related to Auto Accidents, Personal Injury, Wrongful Death & Insurance Dispute Lawyer in Tampa FL

Semrush Rank: 6,369,593
Categories: Business, Business

Similar?
Yes 0 No 0

ddjlawtampa.com
Personal Injury Attorney Tampa FL | Darrigo & Diaz
As one of the oldest law firms in Tampa FL, Darrigo & Diaz is well-equipped to handle your personal injury case. Call us at 813-774-3341.

Categories: Business, Business

Similar?
Yes 0 No 0

kravitzlawgroup.com
Auto Accident | Medical Malpractice Attorney, Brandon Clearwater St. Pete
Auto Accident | Medical Malpractice Attorney Kravitz Law Group, Brandon, Tampa, St. Petersburg, Clearwater, 888-554-9998

Categories: Business, Domain Parking

Similar?
Yes 0 No 0

morlalaw.com
Tampa, Florida Family Law & Personal Injury Attorneys | Morla Law Group
Tampa Bay lawyers at Morla Law Group in Tampa, FL are committed to providing aggressive advocacy and knowledgeable support in family law, bankruptcy & personal injury matters.

Semrush Rank: 3,741,660
Categories: Business, Political Organizations

Similar?
Yes 0 No 0

car-accident-attorney-tampa.com
Car Accident Attorneys | Gibbs & Parnell, P.A. | Tampa, Florida
Over $100 million in settlements & verdicts. If I don't win, I work for free! including fees & costs* Car accident attorneys Tampa

Facebook ♡: 0
Categories: Business, Political Organizations

Similar?
Yes 0 No 0

fiolinjurylaw.com
Tampa Trial Lawyer | Fiol Law Group: Accident & Injury Lawyers
At Fiol Law Group: Accident & Injury Lawyers, we have the experience to help you if you've been injured due to negligence. Call for for a FREE CONSULTATION.

Semrush Rank: 1,315,189
Categories: Business, Business

Similar?
Yes 0 No 0

vallaw.com
Tampa Personal Injury Attorney | Medical Malpractice Lawyer Tampa | Hospital Negligence Florida
If you are a resident of Tampa, Florida, or other Central Florida community and have been injured in an accident, the lawyers at Valenzuela & Stern, P.A., can help you fight for full and fair compensation for your injuries. Call 813-217-5613 for a free consultation with a Florida Board-Certified Civil Trial Specialist right away.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

jfswlaw.com
JFS Law - Tampa Medical Malpractice & Personal Injury Lawyers
Tampa law firm JFS is a medical malpractice & personal injury law firm representing individuals who have been seriously injured or lost due to the negligence of others. Visit our site for a free consult.

Semrush Rank: 3,596,004
Categories: Business, Business

Similar?
Yes 0 No 0

tampatriallawyers.com
Tampa Personal Injury Attorney | Alley, Clark & Greiwe
Alley, Clark & Greiwe is a Tampa based law firm with an average of over 30 years of experience in the area of personal injury, wrongful death, medical malpractice, automobile accidents, and mass tort claims involving defective medical devices and unsafe drug products.

Moz DA: 27 Moz Rank: 3.2 Semrush Rank: 4,635,920 Facebook ♡: 11
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

macgrecojrpa.com
Personal Injury Attorney | Tampa, FL | Greco & Wozniak P.A.
If you need an attorney to help you get compensated for a medical malpractice, vehicular accident, or wrongful death case, Mac A. Greco, Jr., P.A. is the one to call.

Semrush Rank: 6,035,962
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

hersemlaw.com
Hersem Law | Tampa Criminal Defense Lawyer
Picking the right criminal defense attorney in Tampa will impact the severity of your sentence! Don't let a mistake ruin your life. Call 813-544-4162!

Moz DA: 24 Moz Rank: 3.3 Semrush Rank: 877,358
Categories: Business, Business

Similar?
Yes 0 No 0

matthewspersonalinjurylaw.com
Tampa Personal Injury Attorneys | Matthews Injury Law
Matthews Injury Law fights for justice for the injured. Our Tampa and Sarasota personal injury lawyers represent victims of auto accidents, wrongful death and more. Free consultations 813-530-1000.

Semrush Rank: 2,816,553
Categories: Business, Business

Similar?
Yes 0 No 0

tfosterlaw.com
Criminal Defense Attorney Tampa | Criminal Defense Lawyer Fl | Civil Defense Law Firm
We are nationally recognized criminal defense attorney & trial lawyer for civil defense, mail & wire fraud, tax offenses, & financial frauds etc. in Tampa, Florida.

Semrush Rank: 2,430,486
Categories: Business, Business

Similar?
Yes 0 No 0

bjelaw.com
Tampa Personal Injury Lawyer - Esposito Law Car Accident Lawyer
Tampa personal injury law firm helping car accident victims recover millions of dollars. Work with attorney Brian Esposito for 1 on 1 help.

Semrush Rank: 15,350,607
Categories: Business, Business

Similar?
Yes 0 No 0

franco-law.com
Franco Law Group | Attorney | Tampa
Franco Law Group - Tampa Personal Injury Attorney Lawyers - Serving the injured and disabled since 1997

Semrush Rank: 5,138,147
Categories: Business, Business

Similar?
Yes 0 No 0

kmf-law.com
Kynes, Markman & Felman, P.A.
Kynes, Markman & Felman, P.A. is a law firm trusted for more than twenty-five years by individual and business clients across Florida and the United States.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

dennislopezlaw.com
DUI & Traffic Ticket Attorneys in Tampa | Florida Criminal Defense Law Firm | Dennis A. Lopez, Attorney at Law
If you've received a DUI charge or traffic ticket in Tampa, contact Dennis A. Lopez, Attorney at Law for skilled representation.

Semrush Rank: 1,949,572
Categories: Business, Business

Similar?
Yes 0 No 0

injurylawyersoftampa.com
Personal Injury Lawyers of Tampa
The best personal injury lawyers in Tampa, Brandon, and St. Petersburg! If you've been injured in an accident, call us. Se habla español. 813-229-5353

Semrush Rank: 946,157
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

distasiofirm.com
Florida Injury and Accident Lawyers | Distasio Law Firm
If you have been hurt in an accident, contact our Florida personal Injury lawyers from Distasio Law Firm, we are willing and able to go to trial. Call now.

Semrush Rank: 169,904
Categories: Business, Business

Similar?
Yes 0 No 0

zervosinjurylaw.com
Tampa Bay Personal Injury Lawyer - Zervos & Calta, PLLC
Our injury attorneys in Tampa Bay are ready to help you recover the compensation you deserve. Contact us today for a free no-risk consultation.

Semrush Rank: 2,331,414
Categories: Business, Business

Similar?
Yes 0 No 0

ddlawtampa.com
Personal Injury Attorney Tampa FL | Darrigo & Diaz
As one of the oldest law firms in Tampa FL, Darrigo & Diaz is well-equipped to handle your personal injury case. Call us at 813-774-3341.

Semrush Rank: 2,212,078
Categories: Business, Business

Similar?
Yes 0 No 0

whahn-law.com
Tampa Personal Injury Lawyers | Florida Medical Malpractice Attorneys | William E. Hahn, P.A.
Trial attorney William E. Hahn, P.A. represents injured plaintiffs throughout the west coast of Florida, from Tampa to Naples, in medical malpractice, legal malpractice, serious personal injury, and wrongful death cases

Semrush Rank: 6,556,918
Categories: Business, Business

Similar?
Yes 0 No 0

boohofflaw.com
Personal Injury Lawyers | Boohoff Law
If you have been injured due to the negligence of another then you have options! Our firm understands the difficulty that you may be experiencing.

Semrush Rank: 478,312
Categories: Reference/Education, Home/Personal Finance, Business, Business, Business

Similar?
Yes 0 No 0

schropplaw.com
Tampa Bay Civil Trial & Appellate Lawyers | Florida Insurance Coverage Litigation Attorneys
Tampa Bay trial attorneys at the Schropp Law Firm assist clients in Clearwater & Pinellas & Hillsborough counties with Florida insurance coverage disputes, civil litigation & appeals.

Semrush Rank: 13,657,455
Categories: Business, Business

Similar?
Yes 0 No 0

westchaselaw.com
Tampa Divorce Lawyer
Going through a divorce is never easy, but the Tampa divorce lawyers at Westchase Law P.A. are here for you with compassion, care, and understanding.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

lawfran.com
Personal Injury Attorneys - Florida Accident Lawyers | Fran Haasch Law
If you were injured in a serious accident, contact the Tampa Bay personal injury attorneys at The Fran Haasch Law Group. We offer FREE, confidential evaluations.

Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

dennishernandez.com
Florida Auto Accident Attorneys | Dennis Hernandez & Associates, PA
Expert Florida auto accident attorneys of Dennis Hernandez & Associates will fight to get you paid. Harvard Law Graduate. Call 855-529-3366.

Moz DA: 36 Moz Rank: 4 Semrush Rank: 498,823
Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

lorenzoandlorenzo.com
TAMPA Personal Injury Lawyers. We Come to You [Call Now]
Tampa, FL personal injury lawyers dedicated to helping accident victims recover $$$ from loss or damage due to someone else's negligence. No Fee Unless YOU WIN.

Semrush Rank: 330,442
Categories: Business, Political Organizations

Similar?
Yes 0 No 0

thetampainjurylawyer.com
Tampa Bay Injury Lawyer - Tampa Personal Injury Lawyer
Tampa Bay Injury Lawyer - Tampa Personal Injury Lawyer

Semrush Rank: 15,001,161
Categories: Business, ???

Similar?
Yes 0 No 0

fhlawpa.com
Trinity, FL Car Accident Lawyers - Fowkes & Hasanbasic, Accident & Insurance Lawyers
Trinity Car Accident Lawyer - Personal Injury & Insurance Lawyers in Trinity, Florida - Hurt in an accident? Call now for a free consultation.

Semrush Rank: 1,361,674 Facebook ♡: 514
Categories: Business, Business

Similar?
Yes 0 No 0

denmonpearlman.com
Denmon Pearlman | Florida Personal Injury Lawyers
Howard came to Denmon Pearlman looking for help with his auto accident claim after being in a t-bone car accident on his way to dropping off his children at

Semrush Rank: 674,827
Categories: Business, Business

Similar?
Yes 0 No 0

yourtampacriminallawyer.com
Tampa Criminal Attorney | Criminal Defense Lawyer Tampa, FL
Need a local Tampa Criminal Attorney In Florida? We Fight Criminal Charges, Thousands Of Cases Handled. Criminal Defense Lawyer In Tampa

Categories: Business, Business

Similar?
Yes 0 No 0

vanguardattorneys.com
Vanguard Attorneys | Florida Personal Injury Lawyers | Call Now
Have you sustained an injury due to another's negligence within Tampa? Vanguard Injury Attorneys wants to help. Call (813) 471-4444 today.

Semrush Rank: 38,519,928
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

byrdandgonzalezlaw.com
Byrd & Gonzalez | Tampa Personal Injury Attorney
As a Tampa personal injury attorney, we are ready to represent you in personal injury, accidents, and criminal, immigration and family law. Get a free case evaluation!

Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

tampaflcriminaldefenselawyers.com
Criminal Defense Lawyer | St. Petersburg | The Law Office of Timothy Hessinger
The St. Petersburg criminal defense attorney at The Law Office of Timothy Hessinger is former prosecutor with 15+ years' experience. Free consultation!

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

joyceandreyespa.com
Joyce & Reyes – Personal Injury Attorneys
Joyce & Reyes - Personal Injury Attorneys

Semrush Rank: 5,675,544
Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

lawhancock.com
Tampa Personal Injury Lawyer | Hancock Injury Attorneys
Following a serious accident, you need a Tampa personal injury lawyer at Hancock Injury Attorneys to fight for you. Call 813-915-1110.

Moz DA: 37 Moz Rank: 3.5 Semrush Rank: 530,898
Categories: Education/Reference, Reference

Similar?
Yes 0 No 0

morgensternandherd.com
Tampa Personal Injury Lawyers | Florida Medical Malpractice Attorneys
The Tampa personal injury lawyers at Morgenstern & Herd help victims of personal injury accidents and medical malpractice. Call for a free consultation.

Semrush Rank: 3,791,053
Categories: Business, Business

Similar?
Yes 0 No 0

getserious.com
Robert Sparks Attorneys - Robert Sparks Attorneys
Strength. Trust. Results.Robert Sparks Attorneys is a premier Tampa law firm, providing legal support for personal injury law, family law, and divorce

Semrush Rank: 1,126,034
Categories: Business, Business

Similar?
Yes 0 No 0

olalaw.com
Florida Full Service Law Firm. Here When You Need Us
Top-rated Tampa divorce lawyers at Older Lundy Alvarez & Koch handle family law, divorce, personal injury, business litigation, estate planning, probate, tax & more.

Semrush Rank: 844,958
Categories: Business, Business

Similar?
Yes 0 No 0

defendtampa.com
Maj Vasigh | Tampa Criminal Defense Lawyer
When your future is on the line, you need the help of an experienced Tampa criminal defense lawyer who has your best interests at heart. Call Maj Vasigh today for a free consultation.

Categories: Business, Business

Similar?
Yes 0 No 0

criminaldefenselawyertampa.com
Criminal Defense Lawyers of Tampa
Daniel J. Fernandez and Martin J. Hernandez

Semrush Rank: 2,951,296
Categories: Business, Domain Parking

Similar?
Yes 0 No 0

slatergrant.com
Tampa & Wesley Chapel Personal Injury Attorney
Tampa & Wesley Chapel personal injury attorneys Slater | Grant handle car, truck & motorcycle accidents, medical malpractice, legal malpractice defense & more.

Semrush Rank: 2,174,698
Categories: Business, Business

Similar?
Yes 0 No 0

davislawtampa.com
Tampa Divorce Attorneys | Tampa Family Law Attorneys
Tampa Divorce & Family Law Attorneys | Board Certified in Marital & Family Law | Listed as a Best Law Firm for 2021 by U.S. News & World Report. Put a dedicated and experienced team to work for you.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

Suggest Site to this list (matassinilaw.com)

Please only suggest if the website is similar. We do check suggested websites carefully and only approve if it's completely similar.

Site Url

Why do you think it is similar?

Email address We'll never share your email with anyone else. You'll get a confirmation email.

3 (times) seven

I'm sure it's similar Yes

matassinilaw.com Reviews

No reviews have been made yet.

What is sitelike.org?

sitelike.org is a free tool to search and find Similar Websites, alternatives or related to the given site.
It helps you to find similar sites based on keyword overlap and shared audience.
Our team is manually checking and finding similar websites and also our visitors are helping us to find the best similar websites.
"Similar sites like" first finds the best and top keywords for all websites and rank them.
We also use our internal algorithm with analysing the website contents and also several web sources to determine the main topics of websites which are used to find similar websites that have the closest matching set of topics. Our ranking system uses user generated content created by our team, our visitors and also our algorithm.