Similar sites like yourtampalawyer.com

Tampa Criminal Attorney | FL Criminal Lawyer | Caimano Law Firm P.A.

When you need a Tampa criminal attorney, Caimano Law Firm, P.A. is the right place to call for quality representation.

Categories: Business, Government and Legal Organizations
Topics: caimano law firm p.a, criminal attorney tampa, criminal defense attorney tampa fl, fl criminal lawyer, tampa criminal attorney, tampa criminal defense attorney, tampa fl criminal attorney

Semrush Rank: 5,006,157

yourtampalawyer.com Reviews

Sites similar to yourtampalawyer.com - Top 57 yourtampalawyer.com alternatives

tampabaylegalservices.com
Tampa Criminal Attorney | Tampa Criminal Defense Lawyer
Affordable Tampa Criminal Defense Attorney that is experienced and will work for you. We focus on criminal defense law in Tampa Bay Florida. Call us today for a free consultation (813) 857-8237

Categories: Business, Business

Similar?
Yes 0 No 0

williamwynnelaw.com
Tampa Criminal Attorney | Criminal Defense Lawyer Tampa, FL
Need a local Tampa Criminal Attorney In Florida? We Fight Criminal Charges, Thousands Of Cases Handled. Criminal Defense Lawyer In Tampa

Similar?
Yes 0 No 0

c4motion.com
c4motion.com
GoDaddy Security - Access Denied

Categories: Business, Business

Similar?
Yes 0 No 0

tampacriminaldefenders.com
Criminal Defense Attorney Tampa FL | Tampa Criminal Lawyer
Our practice areas If you’ve been charged with a crime in Tampa, FL, you need a criminal defense attorney with extensive trial experience, a high success rate and a dedicated, personalized, compassionate approach to your defense. Whether you need an attorney to dispute a traffic ticket or speeding violation, a lawyer to defend you against … Read more

Semrush Rank: 13,969,060
Categories: Business, Political Organizations

Similar?
Yes 0 No 0

yourtampacriminallawyer.com
Tampa Criminal Attorney | Criminal Defense Lawyer Tampa, FL
Need a local Tampa Criminal Attorney In Florida? We Fight Criminal Charges, Thousands Of Cases Handled. Criminal Defense Lawyer In Tampa

Categories: Business, Business

Similar?
Yes 0 No 0

suarezlawfirm.com
Ed Suarez : Tampa's Top White Collar Criminal Defense Attorney
In a world full of lawyers, you will rarely find trial attorneys as capable, approachable, and committed to their clients as Ed Suarez and Rachel May Zysk. Our attorneys have successfully represented clients in state and federal courts throughout Florida and elsewhere.

Semrush Rank: 3,709,864
Categories: Business, Business

Similar?
Yes 0 No 0

maiellolaw.com
Tampa DUI Criminal Defense Attorney - Maiello Law
Tampa criminal defense attorney and DUI law firm Maiello Law rated the best criminal defense lawyers in Tampa. Top rated DUI attorney in Tampa, Fl.

Semrush Rank: 5,003,428
Categories: Sports, Business

Similar?
Yes 0 No 0

criminalattorneytampa.com
Home - Criminal Defense Attorney - Roger Futerman & Associates
Criminal defense attorney practice in the Tampa Bay area. If you need high powered representation in Pinellas or Hillsborough we are here to help you.

Categories: Non-Profit/Advocacy/NGO, Business

Similar?
Yes 0 No 0

escobarlaw.com
Criminal Defense Attorney Tampa, FL | DUI Defense
Call the experienced Tampa, Florida, criminal defense attorneys at Escobar, Michaels & Associates at 813-513-0274 for a free consultation.

Categories: Business, Web Hosting

Similar?
Yes 0 No 0

defendtampa.com
Maj Vasigh | Tampa Criminal Defense Lawyer
When your future is on the line, you need the help of an experienced Tampa criminal defense lawyer who has your best interests at heart. Call Maj Vasigh today for a free consultation.

Categories: Business, Business

Similar?
Yes 0 No 0

flcriminaldefender.com
Traffic Tickets & Drug Crimes Attorney in Tampa, Florida | The Wade Law Firm
If you need skilled, compassionate legal counsel for your traffic ticket or criminal defense case, call The Wade Law Firm in Tampa to set up a consultation.

Semrush Rank: 15,427,323
Categories: Business, Business

Similar?
Yes 0 No 0

tpatrialattorneys.com
Tampa, FL Criminal Defense | DUI Attorney | Federal Lawyer
Free consultation at Stechschulte Nell for Federal, DUI, s*x, assault, drug crime charges. Call our board certified Tampa, Florida criminal defense lawyer.

Categories: Business, Business

Similar?
Yes 0 No 0

thetampacriminallawyer.com

Tampa DUI, Felony, Drug Charges, Criminal Defense Lawyer – Attorney Ray C. Lopez
Tampa DUI, Felony, Drug Charges, Criminal Defense Lawyer - Attorney Ray C. Lopez

Semrush Rank: 5,613,305
Categories: Business, Business

Similar?
Yes 0 No 0

inlawwetrust.com
Divorce Lawyers For Men Tampa - Divorce For Men Tampa FL | In Law We Trust, P.A.
Experienced divorce lawyers for men in Tampa FL offering a variety of legal services. Call (813) 415-3510 today for a free consultation with a divorce for men specialist.

Semrush Rank: 4,275,941
Categories: Business, Business

Similar?
Yes 0 No 0

josephcrussolaw.com
Joe Russo Law | Your Small Business Lawyer in Tampa, FL |
Joe Russo Law | Your Small Business Lawyer in Tampa, FL |

Semrush Rank: 7,069,862
Categories: Business, Business

Similar?
Yes 0 No 0

tfosterlaw.com
Criminal Defense Attorney Tampa | Criminal Defense Lawyer Fl | Civil Defense Law Firm
We are nationally recognized criminal defense attorney & trial lawyer for civil defense, mail & wire fraud, tax offenses, & financial frauds etc. in Tampa, Florida.

Semrush Rank: 2,430,486
Categories: Business, Business

Similar?
Yes 0 No 0

tampaflcriminaldefenselawyers.com
Criminal Defense Lawyer | St. Petersburg | The Law Office of Timothy Hessinger
The St. Petersburg criminal defense attorney at The Law Office of Timothy Hessinger is former prosecutor with 15+ years' experience. Free consultation!

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

joevinjurylaw.com
Personal Injury Attorney Tampa Florida | Auto Accident Lawyer Tampa
Tampa Personal Injury Lawyer, Joseph Vecchioli, works aggressively to get our clients the compensation they deserve. Call (813) 930-5532.

Semrush Rank: 35,918,841
Categories: Business, Business

Similar?
Yes 0 No 0

thefernandezlawgroup.com
Fernandez Law Group: Tampa Lawyers & Attorneys at Law
Fernandez Law Group Tampa Lawyers & Attorneys at Law: Personal Injury, Criminal Defense, DUI & Traffic Violations. FREE Consultations. 813-489-3222

Semrush Rank: 1,455,969
Categories: Business, Political Organizations

Similar?
Yes 0 No 0

robinfuson.com

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

scs-ph.com
ShieldCrete Philippines | Industrial Coating Protection Specialists
Protect your Assets with CharCoat's Passive Fire Protection Products. Fire Rated FM Approved Electrical Cable Coating, Firestopping, Thin Film Intumescent Paint for Structural Steel and Hydrophobic Coatings for HV Insulator Protection

Semrush Rank: 9,499,011
Categories: Business, Business

Similar?
Yes 0 No 0

bartiluccilaw.com
Test Page for 64.41.156.160
Test Page for 64.41.156.160

Categories: Business, Business

Similar?
Yes 0 No 0

affordablelegalteam.com
Affordable Criminal Defense Attorney | DUI Lawyer Florida
Affordable Criminal Defense Law Firm for Felony, DUI, Misdemeanor and Juvenile crimes, if you are facing a conviction in Florida Contact our Attorneys today.

Semrush Rank: 9,065,538
Categories: Business, Business

Similar?
Yes 0 No 0

thomaslawtampa.com
thomaslawtampa.com
Sucuri WebSite Firewall - Access Denied

Semrush Rank: 1,973,203
Categories: Business, Business

Similar?
Yes 0 No 0

pallegarlawfirm.com
Tampa Criminal Defense Lawyer | Sarasota, Florida DUI Lawyer | Pallegar Law, P.A.
Free Consultation - Call (813) 444-3912 - Pallegar Law, P.A. aggressively represents the accused against charges in Criminal Defense & DUI cases.

Semrush Rank: 589,218
Categories: Business, Business

Similar?
Yes 0 No 0

criminalattorneytampa.net
Criminal Defense Attorney in Tampa, FL - Hanlon Law
Criminal Defense Attorney in Tampa, FL - Hanlon Law | Florida-based criminal defense law firm Hanlon Law is full of winning lawyers. We aggressively defended clients all across FL. Let us fight for you and help you win the fight. Visit our website or call us at (813) 228-7095 to schedule your consultation today!

Semrush Rank: 623,400
Categories: Business, Business

Similar?
Yes 0 No 0

therickmanlawfirm.com
Criminal Defense Attorney Tampa, Best Federal Defense Attorney St. Petersburg, Federal Criminal Defense Lawyer Tampa
The Rickman Law Firm is a Florida Law Firm dedicated to providing superior legal representation in the areas of Criminal Defense, DUI Defense and Personal Injury. If you are in need of legal representation contact Anthony Rickman today for a free consultation.

Semrush Rank: 693,774
Categories: Business, Business

Similar?
Yes 0 No 0

tampacriminaldefenselawyer.com
Tampa Criminal Defense Lawyer, Board-Certified for 20 Years - Lori D. Palmieri, P.A.
Criminal Justice Lawyer Since 1990, Proudly Defending Tampa Since 2003. Lori D. Palmieri, is a Board Certified Criminal Defense Lawyer practicing in the gre

Categories: Government/Military, Government and Legal Organizations

Similar?
Yes 0 No 0

matassinilaw.com
Tampa Car Accident Lawyer
The Tampa car accident lawyers at Matassini Law Firm, P.A. help clients who have been injured in car, truck & motorcycle accidents, call for a free consultation.

Semrush Rank: 2,304,416
Categories: Marketing/Merchandising, Government and Legal Organizations

Similar?
Yes 0 No 0

criminaldefenselawyertampa.com
Criminal Defense Lawyers of Tampa
Daniel J. Fernandez and Martin J. Hernandez

Semrush Rank: 2,951,296
Categories: Business, Domain Parking

Similar?
Yes 0 No 0

hillsboroughdefense.com
Tampa Criminal Defense Attorney | Metcalf Falls, Criminal Defense Attorneys, P.A.
Charged with a crime in Tampa? Get Answers and Protect Yourself. Call Criminal Defense Attorney Brett Metcalf. Free Consults Avail: (813) 258-4800.

Facebook ♡: 52
Categories: Business, Business

Similar?
Yes 0 No 0

cameronviews.com
Cameron Brooks News and Views
Cameron Brooks News and Views

Semrush Rank: 2,822,969
Categories: Blogs/Wiki, Personal Websites and Blogs

Similar?
Yes 0 No 0

purbrands.com
Purbrands - Baby Breast Pump Bottle Nipple - Simply is the best for your Baby
Purbrands - Baby Breast Pump Bottle Nipple - Simply is the best for your Baby

Categories: Business, Business

Similar?
Yes 0 No 0

southwesttitle.com
Southwest Title Company | Premium Title Company and Title Insurance services with reliable and experienced staff in Texarkana Arkansas
Southwest Title Company | Premium Title Company and Title Insurance services with reliable and experienced staff in Texarkana Arkansas

Semrush Rank: 1,969,214
Categories: Business, Business

Similar?
Yes 0 No 0

sahms.org.za
Home - SAHMS - South African Hindu Maha Sabha
Welcome To SAHMS
To encourage the study of Hindu philosophy, religion, literature, arts and science.
The formation of the South African Hindu Maha Sabha as the national body representing the cultural and religious aspirations of South Africa’s Hindu community was the brainchild of an outstanding Sannyasin (monk) who

Semrush Rank: 4,086,395
Categories: Marketing/Merchandising, Arts and Culture

Similar?
Yes 0 No 0

thehardylawfirm.com
thehardylawfirm.com
Sucuri WebSite Firewall - Access Denied

Semrush Rank: 599,241
Categories: Marketing/Merchandising, Political Organizations

Similar?
Yes 0 No 0

mypricelawyers.com
Need a Lawyer | Low Cost Legal Help | My Price Lawyers
FREE Referral - Need affordable legal help with a personal injury, bankruptcy, family law / divorce, traffic ticket, or criminal defense situation? Connect with My Price Lawyer. Our network of affordable attorneys handles cases at a discounted rate.

Categories: Business, Business

Similar?
Yes 0 No 0

dennislopezlaw.com
DUI & Traffic Ticket Attorneys in Tampa | Florida Criminal Defense Law Firm | Dennis A. Lopez, Attorney at Law
If you've received a DUI charge or traffic ticket in Tampa, contact Dennis A. Lopez, Attorney at Law for skilled representation.

Semrush Rank: 1,949,572
Categories: Business, Business

Similar?
Yes 0 No 0

mikeglaw.com
Criminal Defense Attorney Tampa, FL - Protect Your Rights | Mike G Law
Tampa criminal defense attorney and former prosecutor Mike G Law has over 25 years of experience protecting clients’ rights. Get your FREE consultation.

Semrush Rank: 104,652 Facebook ♡: 1,235
Categories: Computers/Software/Operating Systems, Business, Regional/North America, Business, Government and Legal Organizations

Similar?
Yes 0 No 0

injurylawyersoftampa.com
Personal Injury Lawyers of Tampa
The best personal injury lawyers in Tampa, Brandon, and St. Petersburg! If you've been injured in an accident, call us. Se habla español. 813-229-5353

Semrush Rank: 946,157
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

aluunoamais.com.br
Pagina inicial - AluunoA+
Anterior Próximo Escolha o curso ou projeto para seu momento profissional, para sua empresa ou escola. CURSOS EM DESTAQUE EADLer mais

Semrush Rank: 2,857,506
Categories: Business

Similar?
Yes 0 No 0

floridadefense.com
Clearwater Criminal Defense Lawyers | Bauer Crider Kenny & Parry
Arrested? Our Clearwater criminal attorneys have 100+ years of combined trial experience and are ready to offer you strategic guidance. Call 727-205-0968 today!

Semrush Rank: 2,340,584
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

centrallaw.com
Speak to a Criminal Defense Attorney Near Tampa, Florida 813-222-2220 Video
Board Certified Trial Attorney answers questions, videos, 24/7/365

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

galiganilaw.com
Galigani Law Firm
If you are facing a DUI, misdemeanor, or felony charge, contact an experienced attorney at Galigani Law Firm. Lawyer representing Gainesville, Ocala, Lake City, Alachua and surrounding counties.

Semrush Rank: 699,368
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

sghpsldh.in
Sri Guru Harkrishan Public School (Ludhiana)
Sri Guru Harkrishan Public School (Ludhiana)

Semrush Rank: 14,199,702
Categories: Education/Reference, Entertainment

Similar?
Yes 0 No 0

tampafloridacriminallawyer.com
Tampa Criminal Lawyer | Hillsborough County Criminal Defense Attorney | The Mayberry Law Firm
Free Consultation - Call (813) 444-7435 - The Mayberry Law Firm aggressively represents the accused against charges in Criminal & Criminal Defense cases.

Semrush Rank: 902,556
Categories: Sports, Business

Similar?
Yes 0 No 0

rava.org.ua
Рава-Руська міська рада | Офіційна сторінка
Мешканці вулиці 1-го Грудня разом з депутатом м.Рава-Руська Чорним Михайлом Тарасовичем, який обраний у даному окрузі, ініціювали проведення вуличного освітлення.

Semrush Rank: 2,351,583
Categories: Government/Military, Information Technology

Similar?
Yes 0 No 0

theadvocateforyou.com
Tampa Criminal Defense Attorney | Experienced Defense Lawyers
If you are facing criminal charges in Tampa contact our skilled criminal defense attorneys for help. We have the experience you need, call today.

Categories: Blogs/Wiki, Government and Legal Organizations

Similar?
Yes 0 No 0

tampacriminalattorneys.com
Tampa Criminal Defense & DUI Lawyers | Thomas & Paulk
Get a FREE case evaluation with Tampa criminal defense & DUI attorneys at Thomas & Paulk. Thousands of cases handled. Decades of experience. Available 24/7!

Moz DA: 26 Moz Rank: 3.3 Semrush Rank: 366,793
Categories: Business, Business

Similar?
Yes 0 No 0

amatis.org
amatis.org – Amati's Instruments
Amati's Fine Instruments |

Semrush Rank: 937,929
Categories: Marketing/Merchandising, Streaming Media and Download

Similar?
Yes 0 No 0

markjobrien.com
Tampa Criminal Defense Lawyer | O'Brien Hatfield, P.A.
Superb 5.0 rated criminal defense attorneys. Tampa, Florida-based law firm O’Brien Hatfield, P.A. Available 24/7 Call 813-440-2347 for a free, private case review.

Semrush Rank: 416,417 Facebook ♡: 66
Categories: Sports, Government and Legal Organizations

Similar?
Yes 0 No 0

bethelkumc.org
베델연합감리교회 | Bethel Korean United Methodist Church
미국 산호세 산타클라라에 위치한 베델연합감리교회에 오신 여러분을 환영합니다 - Bethel KUMC

Categories: Global Religion

Similar?
Yes 0 No 0

ddjlawtampa.com
Personal Injury Attorney Tampa FL | Darrigo & Diaz
As one of the oldest law firms in Tampa FL, Darrigo & Diaz is well-equipped to handle your personal injury case. Call us at 813-774-3341.

Categories: Business, Business

Similar?
Yes 0 No 0

tampaattorneys.org
Tampa FL Family Law Attorneys – Passionate Representation with a Compassionate Approach
Anton Castro Law is a Tampa law firm of experienced Tampa attorneys and Tampa lawyers. Call 813-907-9807 today if you are in need of a Tampa attorney or lawyer in Tampa.

Categories: Business, Business

Similar?
Yes 0 No 0

rolydundrum.ie
Reid Networks
Reid Networks

Semrush Rank: 4,049,750
Categories: Restaurants, Restaurant and Dining

Similar?
Yes 0 No 0

lacompagnie-events.com
La Compagnie Events Arles - Sonorisation professionnel arles, sonorisation spectacle arles, acoustique spectacle, audiovisuel professionnel arles, illustration sonore, design sonore, occasion sonorisation arles, organisation spectacle
LA COMPAGNIE rassemble des professionnels du son, de la lumière, de la vidéo, du spectacle et de l’événement. Notre expérience du monde du spectacle vivant recouvre toutes les compétences de mise en valeur des sites et des monuments et de création d’événements professionnels.

Semrush Rank: 4,265,952
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

cygnus-instruments.com
Ultrasonic Thickness Gauges | Hatch Cover Tester | Cygnus Instruments
Here at Cygnus Instruments we manufacture and supply ultrasonic thickness gauges for use within many industries worldwide such as civil engineering, offshore, subsea and plant maintenance.

Semrush Rank: 797,371 Facebook ♡: 1,081
Categories: Business, Business

Similar?
Yes 0 No 0

Suggest Site to this list (yourtampalawyer.com)

Please only suggest if the website is similar. We do check suggested websites carefully and only approve if it's completely similar.

Site Url

Why do you think it is similar?

Email address We'll never share your email with anyone else. You'll get a confirmation email.

3 (times) seven

I'm sure it's similar Yes

yourtampalawyer.com Reviews

No reviews have been made yet.

What is sitelike.org?

sitelike.org is a free tool to search and find Similar Websites, alternatives or related to the given site.
It helps you to find similar sites based on keyword overlap and shared audience.
Our team is manually checking and finding similar websites and also our visitors are helping us to find the best similar websites.
"Similar sites like" first finds the best and top keywords for all websites and rank them.
We also use our internal algorithm with analysing the website contents and also several web sources to determine the main topics of websites which are used to find similar websites that have the closest matching set of topics. Our ranking system uses user generated content created by our team, our visitors and also our algorithm.