Similar sites like tampacriminaldefenders.com

Criminal Defense Attorney Tampa FL | Tampa Criminal Lawyer

Our practice areas If you’ve been charged with a crime in Tampa, FL, you need a criminal defense attorney with extensive trial experience, a high success rate and a dedicated, personalized, compassionate approach to your defense. Whether you need an attorney to dispute a traffic ticket or speeding violation, a lawyer to defend you against … Read more

Categories: Business, Political Organizations
Topics: criminal defense attorney tampa fl, tampa criminal lawyer

Semrush Rank: 13,969,060

tampacriminaldefenders.com Reviews

Sites similar to tampacriminaldefenders.com - Top 44 tampacriminaldefenders.com alternatives

yourtampacriminallawyer.com
Tampa Criminal Attorney | Criminal Defense Lawyer Tampa, FL
Need a local Tampa Criminal Attorney In Florida? We Fight Criminal Charges, Thousands Of Cases Handled. Criminal Defense Lawyer In Tampa

Categories: Business, Business

Similar?
Yes 0 No 0

suarezlawfirm.com
Ed Suarez : Tampa's Top White Collar Criminal Defense Attorney
In a world full of lawyers, you will rarely find trial attorneys as capable, approachable, and committed to their clients as Ed Suarez and Rachel May Zysk. Our attorneys have successfully represented clients in state and federal courts throughout Florida and elsewhere.

Semrush Rank: 3,709,864
Categories: Business, Business

Similar?
Yes 0 No 0

affordablelegalteam.com
Affordable Criminal Defense Attorney | DUI Lawyer Florida
Affordable Criminal Defense Law Firm for Felony, DUI, Misdemeanor and Juvenile crimes, if you are facing a conviction in Florida Contact our Attorneys today.

Semrush Rank: 9,065,538
Categories: Business, Business

Similar?
Yes 0 No 0

c4motion.com
c4motion.com
GoDaddy Security - Access Denied

Categories: Business, Business

Similar?
Yes 0 No 0

maiellolaw.com
Tampa DUI Criminal Defense Attorney - Maiello Law
Tampa criminal defense attorney and DUI law firm Maiello Law rated the best criminal defense lawyers in Tampa. Top rated DUI attorney in Tampa, Fl.

Semrush Rank: 5,003,428
Categories: Sports, Business

Similar?
Yes 0 No 0

faulknerlawgroup.com
Tampa Criminal Lawyer
Tampa criminal lawyer David Faulkner handles drug crimes, DUI, s*x crimes, traffic offenses, as well as family law, contested divorce & child custody disputes.

Semrush Rank: 3,606,824
Categories: Business, Business

Similar?
Yes 0 No 0

bartiluccilaw.com
Test Page for 64.41.156.160
Test Page for 64.41.156.160

Categories: Business, Business

Similar?
Yes 0 No 0

scrivenlawfirm.com
Tampa Criminal Lawyer
Tampa criminal lawyer Bryant Scriven helps with DUI, drug charges, traffic offenses, s*x crimes, theft, white-collar, federal criminal law & more.

Semrush Rank: 13,739,517
Categories: Business, Business

Similar?
Yes 0 No 0

thetampacriminallawyer.com

Tampa DUI, Felony, Drug Charges, Criminal Defense Lawyer – Attorney Ray C. Lopez
Tampa DUI, Felony, Drug Charges, Criminal Defense Lawyer - Attorney Ray C. Lopez

Semrush Rank: 5,613,305
Categories: Business, Business

Similar?
Yes 0 No 0

flcriminaldefender.com
Traffic Tickets & Drug Crimes Attorney in Tampa, Florida | The Wade Law Firm
If you need skilled, compassionate legal counsel for your traffic ticket or criminal defense case, call The Wade Law Firm in Tampa to set up a consultation.

Semrush Rank: 15,427,323
Categories: Business, Business

Similar?
Yes 0 No 0

blflorida.com
Bernhardt Law - Criminal Defense Lawyer Palm Harbor
Criminal Defense Lawyers Palm Harbor - Personal Injury - Debt Defense

Semrush Rank: 7,149,420 Facebook ♡: 36
Categories: Business, Business

Similar?
Yes 0 No 0

criminaldefenselawyertampa.com
Criminal Defense Lawyers of Tampa
Daniel J. Fernandez and Martin J. Hernandez

Semrush Rank: 2,951,296
Categories: Business, Domain Parking

Similar?
Yes 0 No 0

criminalattorneytampa.com
Home - Criminal Defense Attorney - Roger Futerman & Associates
Criminal defense attorney practice in the Tampa Bay area. If you need high powered representation in Pinellas or Hillsborough we are here to help you.

Categories: Non-Profit/Advocacy/NGO, Business

Similar?
Yes 0 No 0

tampaduidefenders.com
Tampa Criminal DUI Lawyers | Parks & Braxton
FREE CONSULTATION with a *** DUI Lawyer ***. Contact us IMMEDIATELY so we can help you get the BEST result for your case. Call now!

Categories: Business, Business

Similar?
Yes 0 No 0

yourtampalawyer.com
Tampa Criminal Attorney | FL Criminal Lawyer | Caimano Law Firm P.A.
When you need a Tampa criminal attorney, Caimano Law Firm, P.A. is the right place to call for quality representation.

Semrush Rank: 5,006,157
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

thomaslawtampa.com
thomaslawtampa.com
Sucuri WebSite Firewall - Access Denied

Semrush Rank: 1,973,203
Categories: Business, Business

Similar?
Yes 0 No 0

escobarlaw.com
Criminal Defense Attorney Tampa, FL | DUI Defense
Call the experienced Tampa, Florida, criminal defense attorneys at Escobar, Michaels & Associates at 813-513-0274 for a free consultation.

Categories: Business, Web Hosting

Similar?
Yes 0 No 0

dennislopezlaw.com
DUI & Traffic Ticket Attorneys in Tampa | Florida Criminal Defense Law Firm | Dennis A. Lopez, Attorney at Law
If you've received a DUI charge or traffic ticket in Tampa, contact Dennis A. Lopez, Attorney at Law for skilled representation.

Semrush Rank: 1,949,572
Categories: Business, Business

Similar?
Yes 0 No 0

shraderlawfirm.com
Top Tampa Criminal Defense Attorney - Shrader Mendez & O'Connell in Tampa, Florida
Hillsborough County criminal defense lawwyers in Tampa, Florida, providing top representation for those wrongly accused of crimes in Florida.

Semrush Rank: 3,320,465
Categories: Business, Business

Similar?
Yes 0 No 0

defendtampa.com
Maj Vasigh | Tampa Criminal Defense Lawyer
When your future is on the line, you need the help of an experienced Tampa criminal defense lawyer who has your best interests at heart. Call Maj Vasigh today for a free consultation.

Categories: Business, Business

Similar?
Yes 0 No 0

hillsboroughdefense.com
Tampa Criminal Defense Attorney | Metcalf Falls, Criminal Defense Attorneys, P.A.
Charged with a crime in Tampa? Get Answers and Protect Yourself. Call Criminal Defense Attorney Brett Metcalf. Free Consults Avail: (813) 258-4800.

Facebook ♡: 52
Categories: Business, Business

Similar?
Yes 0 No 0

hersemlaw.com
Hersem Law | Tampa Criminal Defense Lawyer
Picking the right criminal defense attorney in Tampa will impact the severity of your sentence! Don't let a mistake ruin your life. Call 813-544-4162!

Moz DA: 24 Moz Rank: 3.3 Semrush Rank: 877,358
Categories: Business, Business

Similar?
Yes 0 No 0

robinfuson.com

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

tfosterlaw.com
Criminal Defense Attorney Tampa | Criminal Defense Lawyer Fl | Civil Defense Law Firm
We are nationally recognized criminal defense attorney & trial lawyer for civil defense, mail & wire fraud, tax offenses, & financial frauds etc. in Tampa, Florida.

Semrush Rank: 2,430,486
Categories: Business, Business

Similar?
Yes 0 No 0

thehardylawfirm.com
thehardylawfirm.com
Sucuri WebSite Firewall - Access Denied

Semrush Rank: 599,241
Categories: Marketing/Merchandising, Political Organizations

Similar?
Yes 0 No 0

mypricelawyers.com
Need a Lawyer | Low Cost Legal Help | My Price Lawyers
FREE Referral - Need affordable legal help with a personal injury, bankruptcy, family law / divorce, traffic ticket, or criminal defense situation? Connect with My Price Lawyer. Our network of affordable attorneys handles cases at a discounted rate.

Categories: Business, Business

Similar?
Yes 0 No 0

thefernandezlawgroup.com
Fernandez Law Group: Tampa Lawyers & Attorneys at Law
Fernandez Law Group Tampa Lawyers & Attorneys at Law: Personal Injury, Criminal Defense, DUI & Traffic Violations. FREE Consultations. 813-489-3222

Semrush Rank: 1,455,969
Categories: Business, Political Organizations

Similar?
Yes 0 No 0

inlawwetrust.com
Divorce Lawyers For Men Tampa - Divorce For Men Tampa FL | In Law We Trust, P.A.
Experienced divorce lawyers for men in Tampa FL offering a variety of legal services. Call (813) 415-3510 today for a free consultation with a divorce for men specialist.

Semrush Rank: 4,275,941
Categories: Business, Business

Similar?
Yes 0 No 0

injurylawyersoftampa.com
Personal Injury Lawyers of Tampa
The best personal injury lawyers in Tampa, Brandon, and St. Petersburg! If you've been injured in an accident, call us. Se habla español. 813-229-5353

Semrush Rank: 946,157
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

pallegarlawfirm.com
Tampa Criminal Defense Lawyer | Sarasota, Florida DUI Lawyer | Pallegar Law, P.A.
Free Consultation - Call (813) 444-3912 - Pallegar Law, P.A. aggressively represents the accused against charges in Criminal Defense & DUI cases.

Semrush Rank: 589,218
Categories: Business, Business

Similar?
Yes 0 No 0

criminalattorneytampa.net
Criminal Defense Attorney in Tampa, FL - Hanlon Law
Criminal Defense Attorney in Tampa, FL - Hanlon Law | Florida-based criminal defense law firm Hanlon Law is full of winning lawyers. We aggressively defended clients all across FL. Let us fight for you and help you win the fight. Visit our website or call us at (813) 228-7095 to schedule your consultation today!

Semrush Rank: 623,400
Categories: Business, Business

Similar?
Yes 0 No 0

affordablelegalfees.com
Affordable Legal Fees : Low Cost Lawyers in Tampa, Orlando FL
Our affordable Lawyers in Florida can help you when you need a lawyer for auto accidents, divorce, family law, DUIs, or personal injuries.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

tampaflcriminaldefenselawyers.com
Criminal Defense Lawyer | St. Petersburg | The Law Office of Timothy Hessinger
The St. Petersburg criminal defense attorney at The Law Office of Timothy Hessinger is former prosecutor with 15+ years' experience. Free consultation!

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

therickmanlawfirm.com
Criminal Defense Attorney Tampa, Best Federal Defense Attorney St. Petersburg, Federal Criminal Defense Lawyer Tampa
The Rickman Law Firm is a Florida Law Firm dedicated to providing superior legal representation in the areas of Criminal Defense, DUI Defense and Personal Injury. If you are in need of legal representation contact Anthony Rickman today for a free consultation.

Semrush Rank: 693,774
Categories: Business, Business

Similar?
Yes 0 No 0

mikeglaw.com
Criminal Defense Attorney Tampa, FL - Protect Your Rights | Mike G Law
Tampa criminal defense attorney and former prosecutor Mike G Law has over 25 years of experience protecting clients’ rights. Get your FREE consultation.

Semrush Rank: 104,652 Facebook ♡: 1,235
Categories: Computers/Software/Operating Systems, Business, Regional/North America, Business, Government and Legal Organizations

Similar?
Yes 0 No 0

tpatrialattorneys.com
Tampa, FL Criminal Defense | DUI Attorney | Federal Lawyer
Free consultation at Stechschulte Nell for Federal, DUI, s*x, assault, drug crime charges. Call our board certified Tampa, Florida criminal defense lawyer.

Categories: Business, Business

Similar?
Yes 0 No 0

theadvocateforyou.com
Tampa Criminal Defense Attorney | Experienced Defense Lawyers
If you are facing criminal charges in Tampa contact our skilled criminal defense attorneys for help. We have the experience you need, call today.

Categories: Blogs/Wiki, Government and Legal Organizations

Similar?
Yes 0 No 0

tampacriminaldefenselawyer.com
Tampa Criminal Defense Lawyer, Board-Certified for 20 Years - Lori D. Palmieri, P.A.
Criminal Justice Lawyer Since 1990, Proudly Defending Tampa Since 2003. Lori D. Palmieri, is a Board Certified Criminal Defense Lawyer practicing in the gre

Categories: Government/Military, Government and Legal Organizations

Similar?
Yes 0 No 0

centrallaw.com
Speak to a Criminal Defense Attorney Near Tampa, Florida 813-222-2220 Video
Board Certified Trial Attorney answers questions, videos, 24/7/365

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

tampafloridacriminallawyer.com
Tampa Criminal Lawyer | Hillsborough County Criminal Defense Attorney | The Mayberry Law Firm
Free Consultation - Call (813) 444-7435 - The Mayberry Law Firm aggressively represents the accused against charges in Criminal & Criminal Defense cases.

Semrush Rank: 902,556
Categories: Sports, Business

Similar?
Yes 0 No 0

tampaattorneys.org
Tampa FL Family Law Attorneys – Passionate Representation with a Compassionate Approach
Anton Castro Law is a Tampa law firm of experienced Tampa attorneys and Tampa lawyers. Call 813-907-9807 today if you are in need of a Tampa attorney or lawyer in Tampa.

Categories: Business, Business

Similar?
Yes 0 No 0

familymaritallaw.com
Tampa Divorce Attorneys-Free Consult-Top Tampa Family Lawyers FL Near Me
Tampa divorce attorneys & family lawyers. Top Tampa Florida law firm women attorneys for men & women. Free consultation. ⭐ TRUSTED since 1997. Se habla Español.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

tampacriminalattorneys.com
Tampa Criminal Defense & DUI Lawyers | Thomas & Paulk
Get a FREE case evaluation with Tampa criminal defense & DUI attorneys at Thomas & Paulk. Thousands of cases handled. Decades of experience. Available 24/7!

Moz DA: 26 Moz Rank: 3.3 Semrush Rank: 366,793
Categories: Business, Business

Similar?
Yes 0 No 0

markjobrien.com
Tampa Criminal Defense Lawyer | O'Brien Hatfield, P.A.
Superb 5.0 rated criminal defense attorneys. Tampa, Florida-based law firm O’Brien Hatfield, P.A. Available 24/7 Call 813-440-2347 for a free, private case review.

Semrush Rank: 416,417 Facebook ♡: 66
Categories: Sports, Government and Legal Organizations

Similar?
Yes 0 No 0

Suggest Site to this list (tampacriminaldefenders.com)

Please only suggest if the website is similar. We do check suggested websites carefully and only approve if it's completely similar.

Site Url

Why do you think it is similar?

Email address We'll never share your email with anyone else. You'll get a confirmation email.

3 (times) seven

I'm sure it's similar Yes

tampacriminaldefenders.com Reviews

No reviews have been made yet.

What is sitelike.org?

sitelike.org is a free tool to search and find Similar Websites, alternatives or related to the given site.
It helps you to find similar sites based on keyword overlap and shared audience.
Our team is manually checking and finding similar websites and also our visitors are helping us to find the best similar websites.
"Similar sites like" first finds the best and top keywords for all websites and rank them.
We also use our internal algorithm with analysing the website contents and also several web sources to determine the main topics of websites which are used to find similar websites that have the closest matching set of topics. Our ranking system uses user generated content created by our team, our visitors and also our algorithm.