Similar sites like newsandviewsusa.com

Events • Tips • Info - Community magazines published by News & Views USA, Inc. Serving Douglas County, Paulding County, Villa Rica, and Temple in West Georgia. A trusted company and source of advertising for approximately 300 local businesses each month. Ad rates start at $52 per month.

Categories: General News, News and Media
Topics: chapel hill magazine, chapel hill news, douglas county, marietta eye clinic, news and views, villa rica, villarica

Facebook ♡: 390

newsandviewsusa.com Reviews

Sites similar to newsandviewsusa.com - Top 76 newsandviewsusa.com alternatives

lambappraisals.com
Real Estate Appraisals - Paulding County - Cobb County - Douglas County - Carroll County - Polk County - Dallas, GA - Lamb Appraisals, LLC
Lamb Appraisals, LLC - specializing in residential GA Real Estate Property Appraisals.

Similar?
Yes 0 No 0

homesinlawrencekansas.com
McGrew Real Estate Lawrence Kansas Homes for sale lawrence ks, eudora, douglas county, ne kansas Houses for sale buying selling
McGrew Real Estate, Douglas County's largest locally owned real estate firm serving Lawrence, Eudora and Douglas County. Search, homes for sale, houses, property, properties, new construction, open houses, realtors, real estate agents, gold star homes, buying, selling, agents, listings, to buy, to sell.

Categories: Real Estate, Newly Observed Domain

Similar?
Yes 0 No 0

douglascounty-ne.gov
Douglas County - Douglas County, Nebraska
Douglas County Nebraska website.

Semrush Rank: 84,179
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

douglascountysheriff.org
Sheriff | Douglas County, WA
Our department is dedicated to providing effective and efficient law enforcement services; protecting the lives and property of the citizens of Douglas County; and ensuring the protection of all persons constitutional rights.

Categories: Government/Military, Reference

Similar?
Yes 0 No 0

dcfd.org
Douglas County Fire District No. 2 | Douglas County, OR
Providing Fire & EMS services to Douglas County. 1400 Buckhorn Road Roseburg, OR 97470 | 541-673-5503 | [email protected]

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

douglas-county-website.com
Douglas County Georgia Local Business Directory, Government, Public Schools, Parks, Recreation & Tourism
Douglas-County-Website.com provides links to official Government, Public Schools, Parks, Recreation & Tourism websites of Douglas County Georgia

Categories: Travel, Travel

Similar?
Yes 0 No 0

benningtonne.com
City of Bennington, Douglas County, Nebraska - Official Website
City of Bennington, Douglas County, Nebraska - Official Website

Moz DA: 19 Moz Rank: 3.3 Semrush Rank: 551,723 Facebook ♡: 95
Categories: Public Information, Government and Legal Organizations

Similar?
Yes 0 No 0

yoursrc.org
Senior Resource Center - for Douglas County
Senior Resource Center - for Douglas County

Moz DA: 27 Moz Rank: 3.5 Semrush Rank: 1,752,604 Facebook ♡: 268
Categories: Non-Profit/Advocacy/NGO, Business

Similar?
Yes 0 No 0

localtel.com
LocalTel - Phone, Internet, Television, and Security Services for Chelan County, Douglas County, and Grant County
LocalTel - Phone, Internet, Television, and Security Services for Chelan County, Douglas County, and Grant County

Facebook ♡: 0
Categories: Search Engines, Search Engines and Portals

Similar?
Yes 0 No 0

casaofdouglascounty.org
Children's Advocacy | Douglas County, OR | CASA
Here at CASA of Douglas County, we provide safety and emotional stability to children who have been forced to leave their origin homes. Call to learn more.

Categories: Non-Profit/Advocacy/NGO, Business

Similar?
Yes 0 No 0

townofsuperior.net
Town of Superior – Douglas County, Wisconsin
Town of Superior - Douglas County, Wisconsin

Categories: Internet Services, Government and Legal Organizations

Similar?
Yes 0 No 0

fairfieldplantation.com

Home - Fairfield Plantation POA - Villa Rica, Georgia

Home - Fairfield Plantation POA - Villa Rica, Georgia

Semrush Rank: 776,813
Categories: Real Estate, Sports

Similar?
Yes 0 No 0

soundproofinc.com
Sound Proof Custom Car Audio - Stereo - Window Tinting - Custom Car Stereo Douglasville, Hiram, Dallas, Villa Rica, Carrollton, Atlanta
Sound Proof Custom Car Audio is a retail store located in in Douglasville, Georgia. We sell everything from car audio, mobile video, automobile security, radar detectors, wheels and tires, automotive accessories, windows tinting and much, much more.

Semrush Rank: 1,358,894 Facebook ♡: 177
Categories: Marketing/Merchandising, Personal Vehicles

Similar?
Yes 0 No 0

superiordays.com
Superior Days | Douglas County, WI - Official Website
Superior Days | Douglas County, WI - Official Website

Moz DA: 16 Moz Rank: 2.5
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

k9-behavior.com
K9-Behavior Company | Dog Training | Roseburg, Douglas County | OR
Learn to train your dog! K9-Behavior, serving Roseburg & Douglas County,! Group Puppy Classes, Private In-Home Pet Dog Training, Truffle Dog Training, Service Dog Training, and Dog Bite Prevention Training. We can also help with your dog’s behavior problems.

Facebook ♡: 0
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

jhoytthomas.com
J. Hoyt Thomas Funeral Home : Villa Rica, Georgia (GA)
J. Hoyt Thomas Funeral Home | provides complete funeral services to the local community.

Semrush Rank: 749,787
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

dcga.us
Douglas County, GA | Official Website
Douglas County, GA | Official Website

Semrush Rank: 685,438
Categories: Public Information, Government and Legal Organizations

Similar?
Yes 0 No 0

drharveysmiles.com
Dr. M. Dawn Harvey, DMD, PC | Villa Rica, GA
Dr. M. Dawn Harvey, DMD, PC in Villa Rica, Georgia, is committed to caring for more than just your teeth. We work with you to create a beautiful, healthy smile.

Semrush Rank: 1,292,610
Categories: Health, Health and Wellness

Similar?
Yes 0 No 0

mayfieldsbodyshop.com
Mayfields BodyShop Performance and Collision - Villa Rica, Ga-Mayfields Collision Carrollton, Ga-Bremen, Ga-West Ga.
Mayfields Performance Shop - BodyShop- Collision Repair - Hail Damage Rapair - Carrollton, Ga - Villa Rica, Ga, Bremen, Ga

Facebook ♡: 3
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

volunteerdouglascounty.org
Roger Hill Volunteer Center • Douglas County, KS
Roger Hill Volunteer Center • Douglas County, KS

Categories: Education/Reference, Business

Similar?
Yes 0 No 0

topdogpetsitter.com
Top Dog Pet Sitter | Villa Rica, Douglasville, Carrolton, Temple, GA
Top Dog Pet Sitter provides loving, in-your-home pet care for your dogs and cats when you can't be there! Serving Villa Rica and surrounding areas.

Categories: Marketing/Merchandising, Society and Lifestyles

Similar?
Yes 0 No 0

cpuga.com
Computer Repair Douglasville ga,PC repair Dallas ga, Hiram, Villa Rica, Carrolton, Power Springs ,Atlanta Georgia |IT Services in Atlanta,georgia | VOIP / PSTN phone system setup
Computer Repair Douglasville, Villa Rica, Hiram , pc repair Dallas GA , Carrolton,Power Spring,Information Technology ( IT ) Services, Phone system setup /

Moz DA: 22 Moz Rank: 2.2 Semrush Rank: 3,311,117 Facebook ♡: 0
Categories: Internet Services, Information Technology

Similar?
Yes 0 No 0

douglascountyhomecareassistance.com
Home Care | Castle Rock, CO | Douglas County, CO
Home Care Services at Home Care Assistance of Douglas County, CO: Providing professional home care to seniors in need of assistance in Castle Rock, CO

Semrush Rank: 2,919,675
Categories: Marketing/Merchandising, Health and Wellness

Similar?
Yes 0 No 0

carolyngoff.com
Douglas County, Nevada (NV) Real Estate - Courtesy of Carolyn Goff
The road to success may not be paved like the yellow-brick road in Oz, but it sure helps to have a knowledgeable guide to get you where you want to go. As one of the area�s premier real estate professionals, Carolyn Goff uses her extensive area knowledge and broad business background to help you find the way home. She truly is the one to know for your next move.

Semrush Rank: 16,270,295
Categories: Real Estate, Real Estate

Similar?
Yes 0 No 0

douglascountywi.org
Douglas County, WI - Official Website | Official Website
Douglas County, WI - Official Website | Official Website

Facebook ♡: 13
Categories: Public Information, Government and Legal Organizations

Similar?
Yes 0 No 0

yourmarketingsource.com
Southern Sales & Marketing | Promotional Products & Apparel | Villa Rica, GA: HOME
Southern Sales & Marketing | Villa Rica, GA. Best selection of promotional items, apparel and corporate gifts. Let us earn your business with our 1st class service and low prices.

Facebook ♡: 0
Categories: Online Shopping, Shopping

Similar?
Yes 0 No 0

douglascountywa.net
Douglas County, WA | Official Website
Douglas County, WA | Official Website

Facebook ♡: 3
Categories: Public Information, Reference

Similar?
Yes 0 No 0

lafittemop.com
Lafitte Mop Company | Specializing in Wet Mops, Dust Mops, Brooms and Brushes – Villa Rica, GA
Lafitte Mop Company | Specializing in Wet Mops, Dust Mops, Brooms and Brushes - Villa Rica, GA

Semrush Rank: 6,728,920
Categories: Business, Business

Similar?
Yes 0 No 0

carroll-countywebsite.com
Carroll County Shopping Georgia Shopping GA Website - Shopping, Dining, Restaurants, Lodging, Hotels, Real Estate, Salons, Schools, Sports, Automotive, Banking, Shops, Business, Healthcare, Relocation, Travel, Tourism, Vacations, Local, Best, Rated, Sale, Good, Coupon, Discount - Carroll County, Sacred Harp, Bowdon, Bremen, Carrollton, Mount Zion, Roopville, Temple, Villa Rica, Wicks Tavern, Stockmar Gold Mine, Thomas Doresy Boulevard Mirror Lake, J. Tanner State Park, State University of West G
Carroll County Shopping Georgia Shopping GA Website - Shopping, Dining, Restaurants, Lodging, Hotels, Real Estate, Salons, Schools, Sports, Automotive, Banking, Shops, Business, Healthcare, Relocation, Travel, Tourism, Vacations, Local, Best, Rated, Sale, Good, Coupon, Discount - Carroll County, Sacred Harp, Bowdon, Bremen, Carrollton, Mount Zion, Roopville, Temple, Villa Rica, Wicks Tavern, Stockmar Gold Mine, Thomas Doresy Boulevard Mirror Lake, J. Tanner State Park, State University of West Georgia, Clem, Lowell, Tyus, Kanas, Sand Hill, Whitesburg, Waco, Dunaway Gardens, Chattahoochee River, Little Tallapoosa River, New Georgia, Roscoe, Sargent, Ephesus, Tallapoosa, West Georgia Museum, Fairplay, Bowdon Junction, Georgia, GA

Categories: Travel, Education

Similar?
Yes 0 No 0

executivelandscapingga.com
Executive Landscaping, Villa Rica, GA
Top Atlanta Landscape and Hardscape Contractor
Executive Landscaping Company is a full-service landscape and hardscape design, installation and maintenance provider for both residential and commercial properties. We have been servicing the Atlanta area since 1998. Our full-staff professional team has developed beautiful, award-winning landscapes. Superior quality products, top-notch design, maintenance and install craftsmanship are the hallmark

Facebook ♡: 11
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

douglascountycasa.org
CASA volunteer | Douglas County, GA | Help children
Community volunteers, like you, help foster children everyday in Douglas County, GA to find safe, permanent, loving homes.

Semrush Rank: 6,470,944
Categories: Blogs/Wiki, Information Technology

Similar?
Yes 0 No 0

douglascounty-oregon.us
Douglas County, OR | Official Website
Douglas County, OR | Official Website

Semrush Rank: 128,758
Categories: Government/Military, Business

Similar?
Yes 0 No 0

farleyslandscaping.com
Atlanta & W. Georgia Landscaping & Lawn Care - Villa Rica, Douglasville, Lithia Springs, Carrollton, Landscaping, Lawn Care
Atlanta & W. Georgia Landscaping & Lawn Care - Villa Rica, Douglasville, Lithia Springs, Carrollton, Landscaping, Lawn Care

Categories: Real Estate, Business

Similar?
Yes 0 No 0

travismcneil.com
Search HOMES - Castle Pines, Castle Rock, Denver, Douglas County
Search homes in Castle Pines, Castle Rock, Aurora, Denver Metro, Douglas County. Find REO, bank owned, short sale, foreclosed homes.

Categories: Real Estate, Real Estate

Similar?
Yes 0 No 0

douglas.lib.nv.us

Facebook ♡: 0
Categories: Marketing/Merchandising, Reference

Similar?
Yes 0 No 0

jordandechtman.com
Jordan Dechtman Wealth Management Denver | Financial Advisor | Investment Planner Centennial, Douglas County, Castle Rock, Colorado Springs, Highlands Ranch, Greenwood Village, Cherry Hills Village, Columbine, Castle Pines, Boulder, Mapleton Hill, Englewood, Colorado
Jordan Dechtman Wealth Management provides you expert advice, personally delivered for financially successful individuals. Call 303-741-9772

Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

villaricalocksmith.com
Villa Rica Locksmith - Villa Rica, GA 30180
24/7 Emergency Villa Rica Locksmith - (678) 224-8123 Mobile Villa Rica locksmith service from 322 W Wilson St, Villa Rica, GA 30180 Fast, Expert Locksmiths in Villa Rica, Georgia, 30180

Categories: Business, Business

Similar?
Yes 0 No 0

villaricaperu.com
VILLA RICA PERU – Villa Rica – Oxapampa – Pasco – PERU
InformaciÃ³n y noticias sobre el distrito de Villa Rica, ubicado en la provincia de Oxapampa, departamento de Pasco, en el Peru. Selva Central Peru.

Categories: Personal Websites and Blogs

Similar?
Yes 0 No 0

gordonpinesgolfcourse.com
Gordon Pines Golf Course, Gordon, Wisconsin, Douglas County, 6809 E Fire Hill Road
This is the official website for Gordon Pines Golf Course in Gordon, Wisconsin. Here you will find our rates, league information, event calendars, course info and layout, banquet facilities info, directions to our golf course, our photo gallery and more.

Categories: Sports, Society and Lifestyles

Similar?
Yes 0 No 0

douglasville-sewerseptic.com
Douglasville Septic Tank Pumping, Sewer Line Repairs | Dallas GA, Villa Rica
Septic & Sewer Services - Metro Septic - (770) 679-2226 Call the licensed plumbers at our Douglasville Sewer Septic Company for reliable sewer septic services at affordable rates. Excellent customer satisfaction and referrals.

Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

americanhometownrealty.us
Homes and Land for sale Carrollton,Ga, Villa Rica,Ga, West Georgia
Homes and Land For Sale in Carrollton, Ga. Villa Rica, Ga and West Georgia. Buying or Selling, we are your number one source for Real Estate in West Georgia. Including Bremen, Ga, Tallapoosa, Ga, Waco, Ga, Bowdon, Ga, Temple, Ga, Heflin, Al, Ranburne, Al.

Categories: Real Estate, Real Estate

Similar?
Yes 0 No 0

firemed.us
FireMed | Douglas County, OR
Fire Med is a Fire and Ambulance services membership in Central Douglas County, OR.

Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

pennymchenryhydrangeafestival.com
Douglas County, GA • CivicEngage
Douglas County, GA • CivicEngage

Categories: Public Information, Restaurant and Dining

Similar?
Yes 0 No 0

brule-wi.org
Home - Town of Brule, Douglas County, Wisconsin
Welcome to the Town of Brule Douglas County, Wisconsin ~ Home to the River...

Categories: Public Information, Government and Legal Organizations

Similar?
Yes 0 No 0

drtempleton.com
Chiropractor in Bremen, GA & Villa Rica, GA - Bremen Health & Wellness Center
Bremen Family Health & Wellness Center provides chiropractic care. Dr. Ralph Templeton is a Villa Rica Chiropractor, call us today at 770-537-5555!!

Categories: Health, Health and Wellness

Similar?
Yes 0 No 0

krusefarms.com
Kruse Farms located in Roseburg, Douglas County, Oregon. Produce, Market and Gift Baskets.
Kruse Farms located in Roseburg, Douglas County, Oregon. Produce, Market and Gift Baskets.

Categories: Online Shopping, Business

Similar?
Yes 0 No 0

samturcolawoffices.com
Omaha Nebraska Chapter 7 Bankruptcy Attorney | Lincoln NE Chapter 13 Bankruptcy Lawyer | Douglas County
Burdened by debt? Sam Turco Law Offices of Lincoln, Omaha and Grand Island offers experienced bankruptcy and debt relief counsel. Call 402-682-8573 in Omaha or toll-free at 866-593-7397 for a free consultation.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

thecitymenus.com
thecitymenus.com
The City Menus | A menu of local business news in the West Georgia region.

Semrush Rank: 276,659
Categories: General News, Search Engines and Portals

Similar?
Yes 0 No 0

douglascountysentinel.com
douglascountysentinel.com | Douglas County Sentinel's Trusted Information Leader since 1902
douglascountysentinel.com | Douglas County Sentinel's Trusted Information Leader since 1902

Semrush Rank: 634,913
Categories: General News, News and Media

Similar?
Yes 0 No 0

douglascountygeorgia.com
Douglas County Chamber - Where Partnerships and Businesses Thrive
Douglas County Chamber - Where Partnerships and Businesses Thrive

Categories: Public Information, Government and Legal Organizations

Similar?
Yes 0 No 0

douglasvillega.gov
City of Douglasville, GA | Home
City of Douglasville, GA | Home

Semrush Rank: 63,602 Facebook ♡: 4,903
Categories: Public Information, Government and Legal Organizations

Similar?
Yes 0 No 0

downtownvillarica.com
Downtown Villa Rica – A Great Place to Visit!
Downtown Villa Rica - A Great Place to Visit!

Semrush Rank: 1,032,290
Categories: Business, Information Technology

Similar?
Yes 0 No 0

visitdouglasville.com
Douglasville CVB, GA - Official Website | Official Website
Douglasville CVB, GA - Official Website | Official Website

Facebook ♡: 58
Categories: Travel, Travel

Similar?
Yes 0 No 0

villarica.org
City of Villa Rica, GA » Home
City of Villa Rica, GA » Home

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

douglasvillecalendar.com
Calendar - DouglasvilleCalendar.com | A Community Sourced Event Calendar
Calendar - DouglasvilleCalendar.com | A Community Sourced Event Calendar

Categories: Sports, Travel

Similar?
Yes 0 No 0

carrollton-ga.gov
Carrolltonga.com – Altogether Original
Welcome to the Official Website for the City of Carrollton. A Great Place to Live, Learn, Work, and Play.

Facebook ♡: 15
Categories: Education/Reference, Government and Legal Organizations

Similar?
Yes 0 No 0

jeffersonsrestaurant.com
Jeffersons Restaurant
Jeffersons Restaurant

Categories: Restaurants, Restaurant and Dining

Similar?
Yes 0 No 0

thejuicycrab.com
Home | The Juicy Crab
Home | The Juicy Crab

Semrush Rank: 8,682
Categories: Restaurants, Business

Similar?
Yes 0 No 0

thunderzonebowling.com
Home | Thunderzone
Home | Thunderzone

Semrush Rank: 363,467
Categories: Entertainment, Games

Similar?
Yes 0 No 0

developdouglas.com
Home - Elevate Douglas Economic Partnership
Live, Work, Play Outside the Lines Diversity & Growth 25 Minutes to Atlanta & Airport Atlanta’s Last Frontier Diverse, Educated Workforce 1,181,071 Area Labor Force Big Names Call Douglas Home Amazon, Google, Medline … Discover Douglas County, GA Site Selectors Big names in business call Douglas County home, including companies like Google, Amazon, Medline Industries,…

Semrush Rank: 34,374,966 Facebook ♡: 209
Categories: Job Search, General Organizations

Similar?
Yes 0 No 0

pelicanssnoballs.com
Pelican's SnoBalls - Shaved Ice Treats w/ 100 Flavors & 150+ Locations
Pelican's SnoBalls is the leading shaved-ice provider. Offering 100 flavors at hundreds of locations, the Pelican's SnoBalls revolution is now.

Facebook ♡: 390
Categories: Marketing/Merchandising, ,Restaurant and Dining

Similar?
Yes 0 No 0

carrolltonmainstreet.com
Downtown Carrollton – Carrolltonga.com
Carrollton Main Street is a non-profit, public-private partnership dedicated to the enhancement of downtown Carrollton - historically, economically and aesthetically.

Categories: Blogs/Wiki, News and Media

Similar?
Yes 0 No 0

douglasvillegymnastics.com
Home - Douglasville Gymnastics and Cheerleading Club
Douglasville Gymnastics offers instructional classes for recreational/competitve gymnastics and cheerling.

Categories: Marketing/Merchandising, Sports

Similar?
Yes 0 No 0

blurosebistro.com
Blu Rose Art Bistro | Douglasville, GA
The Blu Rose Art Bistro is a hip and trendy new spot nestled in Historic Downtown Douglasville, Ga that connects the community to the Arts. The Bistro...

Categories: Restaurants, Business

Similar?
Yes 0 No 0

wingfactory.com
Wing Factory - Atlanta's best chicken wings and more
Wing Factory - Atlanta's best chicken wings and more

Semrush Rank: 137,246
Categories: Restaurants, Restaurant and Dining

Similar?
Yes 0 No 0

celebratedouglascounty.com
Douglas County, GA | Official Website
Douglas County, GA | Official Website

Semrush Rank: 60,496 Facebook ♡: 175
Categories: Public Information, Government and Legal Organizations

Similar?
Yes 0 No 0

thewestgeorgian.com
The West Georgian
The West Georgian

Categories: Education/Reference, Education

Similar?
Yes 0 No 0

times-georgian.com
Times-Georgian - News, Classifieds, Business, Sports - Carrollton, Georgia
Find News, Classifieds, Business, Sports and more with Carroll County's trusted information leader since 1871, The Times-Georgian newspaper.

Categories: General News, News and Media

Similar?
Yes 0 No 0

artsdouglas.org
Home Page | Cultural Arts Council Douglasville/Douglas County
Since 1986, the Cultural Arts Council Douglasville/Douglas County has offered high quality cultural events and arts activities in our community.

Categories: Art/Culture/Heritage, Education

Similar?
Yes 0 No 0

pocketpleasers.com
Online Coupons in Livingston County, Michigan : Pocket Pleasers
Livingston County Michigan Coupons and Discounts for Over 25 Years : Pocket Pleasers. Local Coupons in Howell, Brighton, Hartland, Pinckney, Whitmore Lake and Fowlerville.

Categories: Business, Shopping

Similar?
Yes 0 No 0

juicycrabaugusta.com
The Juicy Crab – Seafood Restaurant | Augusta, GA 30909 |
The Juicy Crab - Seafood Restaurant | Augusta, GA 30909 |

Semrush Rank: 178,645
Categories: Restaurants, Business

Similar?
Yes 0 No 0

accesspaulding.com
Access Paulding Festivals Shows Concerts Attractions Parks & Recreation Dining Event Facilities Paulding County Dallas Hiram Tourism
Paulding Tourism Local Events Dallas Theater's Shows, Main Street Players; Concerts in Downtown Dallas; Food Trucks, Festivals; Parades; 4th of July Fireworks; Car Cruises. Dallas Gazebo Trailhead, Historical Paulding County Courthouse, Hiram Rosenwald School Museum, High Shoals Falls, Pickett's Mill Battlefield, Paulding Fine Arts. Parks & Recreation, walking trails, playgrounds, fishing, sports, Silver Comet. Dining Casual, Bakeries, BBQ, Coffee Shops, Mexican, Pizza, and Caterers.

Facebook ♡: 94
Categories: Public Information, News and Media

Similar?
Yes 0 No 0

carrolltonarts.org
Carrollton Center for the Arts – Altogether Creative
Carrollton Center for the Arts - Altogether Creative

Semrush Rank: 10,263,068
Categories: Art/Culture/Heritage, Business

Similar?
Yes 0 No 0

marcos-pizza.net
Marco's Pizza Marco's Italian Restaurant & Pizzeria
Marco's Pizza Marco's Italian Restaurant & Pizzeria

Categories: Restaurants, Restaurant and Dining

Similar?
Yes 0 No 0

citystation.org
City Station
City Station is a Community Center for Carrollton, GA featuring a Fitness
Center, Preschool, Restaurant, Gym, Student Housing, Biblical Counseling
Center, and Ballrooms.

Semrush Rank: 979,719
Categories: Real Estate, General Organizations

Similar?
Yes 0 No 0

motortrendgroup.com
MotorTrendGroup - The Largest Automotive Media Company In The World
MotorTrendGroup - The Largest Automotive Media Company In The World

Semrush Rank: 265,456
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

Suggest Site to this list (newsandviewsusa.com)

Please only suggest if the website is similar. We do check suggested websites carefully and only approve if it's completely similar.

Site Url

Why do you think it is similar?

Email address We'll never share your email with anyone else. You'll get a confirmation email.

3 (times) seven

I'm sure it's similar Yes

newsandviewsusa.com Reviews

No reviews have been made yet.

What is sitelike.org?

sitelike.org is a free tool to search and find Similar Websites, alternatives or related to the given site.
It helps you to find similar sites based on keyword overlap and shared audience.
Our team is manually checking and finding similar websites and also our visitors are helping us to find the best similar websites.
"Similar sites like" first finds the best and top keywords for all websites and rank them.
We also use our internal algorithm with analysing the website contents and also several web sources to determine the main topics of websites which are used to find similar websites that have the closest matching set of topics. Our ranking system uses user generated content created by our team, our visitors and also our algorithm.