Similar sites like yoursrc.org

yoursrc.org Edit Report

Senior Resource Center - for Douglas County

Senior Resource Center - for Douglas County

Categories: Non-Profit/Advocacy/NGO, Business
Topics: douglas county, for douglas county, senior resource center

Moz DA: 27 Moz Rank: 3.5 Semrush Rank: 1,752,604 Facebook ♡: 268

yoursrc.org Reviews

Sites similar to yoursrc.org - Top 77 yoursrc.org alternatives

townofhighland.net
Town of Highland, Douglas County, Wisconsin | Official Website of the Town of Highland, Douglas County, Wisconsin
Town of Highland, Douglas County, Wisconsin | Official Website of the Town of Highland, Douglas County, Wisconsin

Semrush Rank: 3,060,201
Categories: Travel, Government and Legal Organizations

Similar?
Yes 0 No 0

lambappraisals.com
Real Estate Appraisals - Paulding County - Cobb County - Douglas County - Carroll County - Polk County - Dallas, GA - Lamb Appraisals, LLC
Lamb Appraisals, LLC - specializing in residential GA Real Estate Property Appraisals.

Similar?
Yes 0 No 0

villageofpoplar.com
Village of Poplar, Douglas County, Wisconsin | Official Website of the Village of Poplar
Village of Poplar, Douglas County, Wisconsin | Official Website of the Village of Poplar

Semrush Rank: 1,818,957
Categories: Public Information, Government and Legal Organizations

Similar?
Yes 0 No 0

homesinlawrencekansas.com
McGrew Real Estate Lawrence Kansas Homes for sale lawrence ks, eudora, douglas county, ne kansas Houses for sale buying selling
McGrew Real Estate, Douglas County's largest locally owned real estate firm serving Lawrence, Eudora and Douglas County. Search, homes for sale, houses, property, properties, new construction, open houses, realtors, real estate agents, gold star homes, buying, selling, agents, listings, to buy, to sell.

Categories: Real Estate, Newly Observed Domain

Similar?
Yes 0 No 0

douglascounty-ne.gov
Douglas County - Douglas County, Nebraska
Douglas County Nebraska website.

Semrush Rank: 84,179
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

douglascountysheriff.org
Sheriff | Douglas County, WA
Our department is dedicated to providing effective and efficient law enforcement services; protecting the lives and property of the citizens of Douglas County; and ensuring the protection of all persons constitutional rights.

Categories: Government/Military, Reference

Similar?
Yes 0 No 0

dccasa.org
CASA | Douglas County, KS
IES is multipurpose Twitter Bootstrap 3 template which is suitable for any type of business or online project.

Semrush Rank: 7,151,125 Facebook ♡: 1,079
Categories: Non-Profit/Advocacy/NGO, General Organizations

Similar?
Yes 0 No 0

townofmaple.com
Town of Maple, Douglas County, Wisconsin | Official Website of the Town of Maple
Town of Maple, Douglas County, Wisconsin | Official Website of the Town of Maple

Semrush Rank: 1,928,387
Categories: Public Information, Government and Legal Organizations

Similar?
Yes 0 No 0

dcfd.org
Douglas County Fire District No. 2 | Douglas County, OR
Providing Fire & EMS services to Douglas County. 1400 Buckhorn Road Roseburg, OR 97470 | 541-673-5503 | [email protected]

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

douglas-county-website.com
Douglas County Georgia Local Business Directory, Government, Public Schools, Parks, Recreation & Tourism
Douglas-County-Website.com provides links to official Government, Public Schools, Parks, Recreation & Tourism websites of Douglas County Georgia

Categories: Travel, Travel

Similar?
Yes 0 No 0

benningtonne.com
City of Bennington, Douglas County, Nebraska - Official Website
City of Bennington, Douglas County, Nebraska - Official Website

Moz DA: 19 Moz Rank: 3.3 Semrush Rank: 551,723 Facebook ♡: 95
Categories: Public Information, Government and Legal Organizations

Similar?
Yes 0 No 0

localtel.com
LocalTel - Phone, Internet, Television, and Security Services for Chelan County, Douglas County, and Grant County
LocalTel - Phone, Internet, Television, and Security Services for Chelan County, Douglas County, and Grant County

Facebook ♡: 0
Categories: Search Engines, Search Engines and Portals

Similar?
Yes 0 No 0

helpingelders.com
Senior Resource Center | Elder Care & Planning Resources
Helping seniors and families by offering comprehensive solutions for Care Coordination, Financial Protection, Medicaid Planning & Legal Service Coordination.

Moz DA: 17 Moz Rank: 3.3 Semrush Rank: 1,593,725 Facebook ♡: 622
Categories: Business, Business

Similar?
Yes 0 No 0

jhawkaaa.org
Jayhawk Area Agency on Aging | Helping Older Adults Live Independent and Dignified Lives
Jayhawk Area Agency on Aging | Helping Older Adults Live Independent and Dignified Lives

Semrush Rank: 1,355,756
Categories: Business, General Organizations

Similar?
Yes 0 No 0

casaofdouglascounty.org
Children's Advocacy | Douglas County, OR | CASA
Here at CASA of Douglas County, we provide safety and emotional stability to children who have been forced to leave their origin homes. Call to learn more.

Categories: Non-Profit/Advocacy/NGO, Business

Similar?
Yes 0 No 0

townofsuperior.net
Town of Superior – Douglas County, Wisconsin
Town of Superior - Douglas County, Wisconsin

Categories: Internet Services, Government and Legal Organizations

Similar?
Yes 0 No 0

superiordays.com
Superior Days | Douglas County, WI - Official Website
Superior Days | Douglas County, WI - Official Website

Moz DA: 16 Moz Rank: 2.5
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

k9-behavior.com
K9-Behavior Company | Dog Training | Roseburg, Douglas County | OR
Learn to train your dog! K9-Behavior, serving Roseburg & Douglas County,! Group Puppy Classes, Private In-Home Pet Dog Training, Truffle Dog Training, Service Dog Training, and Dog Bite Prevention Training. We can also help with your dog’s behavior problems.

Facebook ♡: 0
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

dcga.us
Douglas County, GA | Official Website
Douglas County, GA | Official Website

Semrush Rank: 685,438
Categories: Public Information, Government and Legal Organizations

Similar?
Yes 0 No 0

volunteerdouglascounty.org
Roger Hill Volunteer Center • Douglas County, KS
Roger Hill Volunteer Center • Douglas County, KS

Categories: Education/Reference, Business

Similar?
Yes 0 No 0

townofoakland.net
Town Of Oakland, Wisconsin - Douglas County
Town Of Oakland, Wisconsin - Douglas County

Semrush Rank: 6,030,822
Categories: Public Information, Business

Similar?
Yes 0 No 0

douglascountyhomecareassistance.com
Home Care | Castle Rock, CO | Douglas County, CO
Home Care Services at Home Care Assistance of Douglas County, CO: Providing professional home care to seniors in need of assistance in Castle Rock, CO

Semrush Rank: 2,919,675
Categories: Marketing/Merchandising, Health and Wellness

Similar?
Yes 0 No 0

carolyngoff.com
Douglas County, Nevada (NV) Real Estate - Courtesy of Carolyn Goff
The road to success may not be paved like the yellow-brick road in Oz, but it sure helps to have a knowledgeable guide to get you where you want to go. As one of the area�s premier real estate professionals, Carolyn Goff uses her extensive area knowledge and broad business background to help you find the way home. She truly is the one to know for your next move.

Semrush Rank: 16,270,295
Categories: Real Estate, Real Estate

Similar?
Yes 0 No 0

douglascountywi.org
Douglas County, WI - Official Website | Official Website
Douglas County, WI - Official Website | Official Website

Facebook ♡: 13
Categories: Public Information, Government and Legal Organizations

Similar?
Yes 0 No 0

douglascountywa.net
Douglas County, WA | Official Website
Douglas County, WA | Official Website

Facebook ♡: 3
Categories: Public Information, Reference

Similar?
Yes 0 No 0

townofhawthorne.org
Town of Hawthorne, Douglas County, Wisconsin | Official Website of the Town of Hawthorne
Town of Hawthorne, Douglas County, Wisconsin | Official Website of the Town of Hawthorne

Semrush Rank: 2,028,391
Categories: Public Information, Business

Similar?
Yes 0 No 0

newsandviewsusa.com
Events • Tips • Info - Community magazines published by News & Views USA, Inc. Serving Douglas County, Paulding County, Villa Rica, and Temple in West Georgia. A trusted company and source of advertising for approximately 300 local businesses each month. Ad rates start at $52 per month.

Facebook ♡: 390
Categories: General News, News and Media

Similar?
Yes 0 No 0

eastforkjusticecourt.com
East Fork Justice Court - Douglas County, Nevada
The official website for East Fork Justice Court in the town of Minden, Douglas County, Nevada, USA.

Semrush Rank: 2,534,286 Facebook ♡: 16
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

larkspurfire.org
Fire and emgergency medical department | Douglas County, CO | larkspurfire.org
Fire and emergency medical services provided by the personnel of Larkspur Fire Protection District in Larkspur, CO. 9414 Spruce Mountain Road 80113

Semrush Rank: 2,279,804
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

wegrowbiz.org
The Development Association | We grow business in Superior & Douglas County, WI.
The Development Association | We grow business in Superior & Douglas County, WI.

Semrush Rank: 8,049,872
Categories: Business, Business

Similar?
Yes 0 No 0

celebratedouglascounty.com
Douglas County, GA | Official Website
Douglas County, GA | Official Website

Semrush Rank: 60,496 Facebook ♡: 175
Categories: Public Information, Government and Legal Organizations

Similar?
Yes 0 No 0

douglascountycasa.org
CASA volunteer | Douglas County, GA | Help children
Community volunteers, like you, help foster children everyday in Douglas County, GA to find safe, permanent, loving homes.

Semrush Rank: 6,470,944
Categories: Blogs/Wiki, Information Technology

Similar?
Yes 0 No 0

srcnj.org
Senior Resource Center | Just another WordPress site
Senior Resource Center | Just another WordPress site

Semrush Rank: 4,781,923
Categories: Non-Profit/Advocacy/NGO, Business

Similar?
Yes 0 No 0

meridiangrouprealestate.com
Castle Rock Real Estate | Highlands Ranch Real Estate | Douglas County
The Meridian Group takes a different approach to Real Estate, one that is built on personal touches, win-win deals and positive results. Call us for Real Estate in Castle Rock, Highlands Ranch, Douglas County and surrounding areas

Semrush Rank: 6,552,175
Categories: Real Estate, Real Estate

Similar?
Yes 0 No 0

douglascounty-oregon.us
Douglas County, OR | Official Website
Douglas County, OR | Official Website

Semrush Rank: 128,758
Categories: Government/Military, Business

Similar?
Yes 0 No 0

travismcneil.com
Search HOMES - Castle Pines, Castle Rock, Denver, Douglas County
Search homes in Castle Pines, Castle Rock, Aurora, Denver Metro, Douglas County. Find REO, bank owned, short sale, foreclosed homes.

Categories: Real Estate, Real Estate

Similar?
Yes 0 No 0

douglas.lib.nv.us

Facebook ♡: 0
Categories: Marketing/Merchandising, Reference

Similar?
Yes 0 No 0

southpineryhoa.com
Pinery South (Pinery 8b) HOA - Douglas County, Colorado
Pinery South (Pinery 8b) HOA - Douglas County, Colorado

Semrush Rank: 18,781,651
Categories: Blogs/Wiki, Business

Similar?
Yes 0 No 0

samturcolawoffices.com
Omaha Nebraska Chapter 7 Bankruptcy Attorney | Lincoln NE Chapter 13 Bankruptcy Lawyer | Douglas County
Burdened by debt? Sam Turco Law Offices of Lincoln, Omaha and Grand Island offers experienced bankruptcy and debt relief counsel. Call 402-682-8573 in Omaha or toll-free at 866-593-7397 for a free consultation.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

krusefarms.com
Kruse Farms located in Roseburg, Douglas County, Oregon. Produce, Market and Gift Baskets.
Kruse Farms located in Roseburg, Douglas County, Oregon. Produce, Market and Gift Baskets.

Categories: Online Shopping, Business

Similar?
Yes 0 No 0

firemed.us
FireMed | Douglas County, OR
Fire Med is a Fire and Ambulance services membership in Central Douglas County, OR.

Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

pennymchenryhydrangeafestival.com
Douglas County, GA • CivicEngage
Douglas County, GA • CivicEngage

Categories: Public Information, Restaurant and Dining

Similar?
Yes 0 No 0

gordonpinesgolfcourse.com
Gordon Pines Golf Course, Gordon, Wisconsin, Douglas County, 6809 E Fire Hill Road
This is the official website for Gordon Pines Golf Course in Gordon, Wisconsin. Here you will find our rates, league information, event calendars, course info and layout, banquet facilities info, directions to our golf course, our photo gallery and more.

Categories: Sports, Society and Lifestyles

Similar?
Yes 0 No 0

brule-wi.org
Home - Town of Brule, Douglas County, Wisconsin
Welcome to the Town of Brule Douglas County, Wisconsin ~ Home to the River...

Categories: Public Information, Government and Legal Organizations

Similar?
Yes 0 No 0

jordandechtman.com
Jordan Dechtman Wealth Management Denver | Financial Advisor | Investment Planner Centennial, Douglas County, Castle Rock, Colorado Springs, Highlands Ranch, Greenwood Village, Cherry Hills Village, Columbine, Castle Pines, Boulder, Mapleton Hill, Englewood, Colorado
Jordan Dechtman Wealth Management provides you expert advice, personally delivered for financially successful individuals. Call 303-741-9772

Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

commissioners.douglascounty-ne.gov
Home - Douglas County, Nebraska - Home
Douglas County Nebraska website.

Semrush Rank: 69,438
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

analytics.douglascounty-ne.gov
analytics.douglascounty-ne.gov | Douglas County, NE web traffic.
Official data on web traffic to all Douglas County, NE websites.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

sheriff.douglascountynv.gov
Home - Douglas County, NV Sheriff
Home - Douglas County, NV Sheriff

Semrush Rank: 75,789
Categories: Public Information, Government and Legal Organizations

Similar?
Yes 0 No 0

downtownlawrence.com
Downtown Lawrence - The Heart of the City
The Heart of the City

Categories: Public Information, Society and Lifestyles

Similar?
Yes 0 No 0

lawrencekids.net
Lawrence Kids Calendar
Your best source to find family fun in Lawrence KS this week!

Semrush Rank: 11,991,450
Categories: Education/Reference, Information Technology

Similar?
Yes 0 No 0

unmistakablylawrence.com
Explore - Unmistakably Lawrence
Explore Unmistakably Lawrence to find out about great attractions, hotels, events, activities and plan your Kansas getaway with our Visitor's Guide!

Semrush Rank: 173,208 Facebook ♡: 2,472
Categories: Arts, Reference/Education, Shopping/Crafts, Travel, Arts and Culture

Similar?
Yes 0 No 0

eastlawrence.com
East Lawrence Neighborhood Association
East Lawrence Neighborhood Association

Semrush Rank: 9,822,055
Categories: Blogs/Wiki, Business

Similar?
Yes 0 No 0

lawrencemow.org
Lawrence Meals on Wheels » Feeding neighbors in need since 1970
Lawrence Meals on Wheels » Feeding neighbors in need since 1970

Semrush Rank: 7,841,772
Categories: Non-Profit/Advocacy/NGO, General Organizations

Similar?
Yes 0 No 0

kchomecare.com
403 Forbidden
403 Forbidden

Categories: Business, Health and Wellness

Similar?
Yes 0 No 0

gardeningideas.org
Gardening Ideas – Inspiring Those Green Thumb Moments.
Gardening Ideas

Categories: Recreation/Hobbies, Society and Lifestyles

Similar?
Yes 0 No 0

kabc.org
Kansas Advocates for Better Care - Advocating for Quality Long-Term Care
Kansas Advocates for Better Care - Advocating for Quality Long-Term Care

Semrush Rank: 3,260,321
Categories: Marketing/Merchandising, Health and Wellness

Similar?
Yes 0 No 0

livelawrencelife.com
Social News - News
Social News - News

Categories: Public Information, Business

Similar?
Yes 0 No 0

baldwincitychamber.com
Baldwin City Chamber of Commerce Home
The Baldwin City Chamber of Commerce provides leadership, promotes and influences economic vitality, and enhances quality of life to benefit the community.

Categories: Education/Reference, Government and Legal Organizations

Similar?
Yes 0 No 0

replaylounge.com
Replay Lounge Home - Replay Lounge
Replay Lounge Home - Replay Lounge

Facebook ♡: 36
Categories: Entertainment, Streaming Media and Download

Similar?
Yes 0 No 0

stephensre.com
HOME - Stephens Real Estate
FIND WHAT YOU LOVE You’ll love working with Stephens For over 40 years, Stephens Real Estate has proudly served Lawrence and its surrounding area. We’ve never lost sight of the values that led to our success. We are still independent, still full-service, and still linked to the community through roots that run decades deep. We … HOME Read More »

Categories: Real Estate, Real Estate

Similar?
Yes 0 No 0

sfchampss.org
CHAMPSS, nutritious meals for seniors in San Francisco.
CHAMPSS is a program for adults 60 or older and their spouse/partners regardless of age. CHAMPSS provides seniors with a dietitian-approved menu, giving them the ability to sit down and enjoy a complete meal together.

Semrush Rank: 1,133,312
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

seniormonthly.net
Kaw Valley Senior Monthly
Kaw Valley Senior Monthly

Categories: Entertainment, Business

Similar?
Yes 0 No 0

thegranada.com
The Granada | Home
The Granada | Home

Categories: Marketing/Merchandising, Entertainment

Similar?
Yes 0 No 0

gardening-abc.com
Gardening ABC - Short And Simple Gardening Tips
Gardening tips that are simple to understand and easy to follow.

Semrush Rank: 4,165,467 Facebook ♡: 1,293
Categories: Home/Gardening, News/Colleges and Universities, Society/Law, Online Shopping, Business

Similar?
Yes 0 No 0

seniorservicesofwichita.org
Welcome to Senior Services of Wichita | Enriching Lives
Senior Services enriches the lives of individuals 55+ with our center events, employment opportunities, health & nutrition programs, and so much more!

Categories: Non-Profit/Advocacy/NGO, Health and Wellness

Similar?
Yes 0 No 0

ldcha.org
LDCHA Home | Select Your Status To Get Started
Welcome to the Lawrence-Douglas County Housing Authority Website. We seek to help the community of Douglas County by offering affordable housing to people that are eligible for the programs that are available. Take a look and see what is available for you and your family.

Semrush Rank: 1,240,955
Categories: Real Estate, Government and Legal Organizations

Similar?
Yes 0 No 0

lawrencebusinessmagazine.com
Lawrence Business Magazine LLC — Make a Positive Impact
Lawrence Business Magazine LLC — Make a Positive Impact

Moz DA: 20 Moz Rank: 3.6 Semrush Rank: 1,684,001 Facebook ♡: 979
Categories: General News, Business

Similar?
Yes 0 No 0

cityofeudoraks.gov
Eudora, KS - Official Website | Official Website
Eudora, KS - Official Website | Official Website

Semrush Rank: 429,371
Categories: Public Information, Government and Legal Organizations

Similar?
Yes 0 No 0

tihc.org
Trinity In-Home Care
Trinity In-Home Care promotes greater independence to families and
individuals of all ages by providing quality respite and support services.
We strive to provide a community-based alternative to prevent or delay the
institutionalization of children and adults with disabilities, and to
assist older adults to remain in their own homes, with family or primary
caregivers. Our services are personalized to the client's needs and Trinity
In-Home Care's Direct Support Professionals (DSPs) are carefully matched to
the client. Our fees are below local and national averages.

Semrush Rank: 2,915,429
Categories: Business

Similar?
Yes 0 No 0

lawrencechamber.com
The Chamber - Lawrence, Kansas. • Growth. Leadership. Advocacy.
Growth. Leadership. Advocacy.

Facebook ♡: 27
Categories: Non-Profit/Advocacy/NGO, General Organizations

Similar?
Yes 0 No 0

unitedwaydgco.org
United Way of Kaw Valley |
United Way of Kaw Valley |

Categories: Marketing/Merchandising, General Organizations

Similar?
Yes 0 No 0

agewisekc.com
agewisekc.com
GoDaddy Security - Access Denied

Semrush Rank: 7,346,520
Categories: Business, Business

Similar?
Yes 0 No 0

lawrence.com
Lawrence, Kansas - entertainment, music, arts and events calendars
Lawrence, Kansas - entertainment, music, arts and events calendars . Sir Lawrence Andrew Common (31 March 1889 â€“ 6 April 1953) was a British shipping director.Common was born in Sunderland, County Durham, the son of Francis James Common (1847â€“1903), an iron merchant from Darlington, and his wife, Annie Elizabeth (nÃ©e Walford) of Banbury, Oxfordshire. His aunt, Emma Jane Common, was the wife of the Nonconformist divine, Joseph Parker. In 1911, he joined the Territorial Army as a second lieutenant in the 3rd Northumbrian (County of Durham) Brigade of the Royal Field Artillery retiring at the end of the war with the rank of Major and he was appointed a Companion of the Distinguished Service Order in 1917 for his services during World War I. In the 1945 New Year Honours, Common was appointed a knight bachelor by George VI for his work with the Ministry of War Transport during World War II and knighted at Buckingham Palace in 1945. He was also appointed a Commander of the Order of Orange-Nassau by Queen Wilhelmina of the Netherlands, for his services to her country during the war.In 1952, Common was appointed a Deputy Lieutenant of County Durham and High Sheriff of that county in 1953, having previously been nominated in 1950 and 1952.In 1923, Common had married Bessie Reid Pollock (1895â€“1959), a daughter of Gilbert Reid Pollock (1865â€“?), an iron engineer from Neilston, Renfrewshire, and his wife, Annie (nÃ©e Blackwell) of Hyde, Cheshire. They had three children, Joyce A. (born 1924), Elizabeth A. (born 1926) and Gilbert A. (born 1930).Common died in 1953 and was buried in Edmundbyers, County Durham, near to his home, Hunter House on the banks of Derwent Reservoir.

Semrush Rank: 207,395 Facebook ♡: 0
Categories: Public Information, Entertainment

Similar?
Yes 0 No 0

kseldercare.com
Kansas Elder Care | Senior Caregiver in Topeka
Kansas Elder Care's unmatched experience, trained caregivers and affordable rates make it your leading choice for elder care services in Topeka and Lawrence.

Semrush Rank: 13,240,089
Categories: Marketing/Merchandising, Health and Wellness

Similar?
Yes 0 No 0

baldwincity.org
Baldwin City, KS | Official Website
Baldwin City, KS

Categories: Public Information, Government and Legal Organizations

Similar?
Yes 0 No 0

seniorresourcecenter.net
Senior Resource Center |
Senior Resource Center |

Categories: Health, Business

Similar?
Yes 0 No 0

livewelllawrence.org
LiveWell Lawrence makes it easier for local residents to eat healthy foods and be physically active. | LiveWell Lawrence
LiveWell Lawrence makes it easier for local residents to eat healthy foods and be physically active. | LiveWell Lawrence

Categories: Public Information, Restaurant and Dining

Similar?
Yes 0 No 0

Suggest Site to this list (yoursrc.org)

Please only suggest if the website is similar. We do check suggested websites carefully and only approve if it's completely similar.

Site Url

Why do you think it is similar?

Email address We'll never share your email with anyone else. You'll get a confirmation email.

3 (times) seven

I'm sure it's similar Yes

yoursrc.org Reviews

No reviews have been made yet.

What is sitelike.org?

sitelike.org is a free tool to search and find Similar Websites, alternatives or related to the given site.
It helps you to find similar sites based on keyword overlap and shared audience.
Our team is manually checking and finding similar websites and also our visitors are helping us to find the best similar websites.
"Similar sites like" first finds the best and top keywords for all websites and rank them.
We also use our internal algorithm with analysing the website contents and also several web sources to determine the main topics of websites which are used to find similar websites that have the closest matching set of topics. Our ranking system uses user generated content created by our team, our visitors and also our algorithm.