Similar sites like quotesearch.com

QuoteSearch - Compare Life Insurance, Funeral Plans and More | QuoteSearch

Find the lowest prices at QuoteSearch. Compare the cheapest life insurance, funeral plans, business solutions and equity release. Free no-obligation quotes.

Categories: Finance/Banking, Finance and Banking
Topics: buy to let, compare life insurance, funeral plans and more, health insurance, house purchase, income protection, key man insurance, key man insurance quote, life insurance, mortgages, private medical insurance, quote search, quotes search, quotesearch, secured loans, unsecured loans

Facebook ♡: 0

quotesearch.com Reviews

Sites similar to quotesearch.com - Top 36 quotesearch.com alternatives

quotesearch.co.uk
Car Insurance
Car Insurance

Categories: Finance/Banking, Brokerage and Trading

Similar?
Yes 0 No 0

premierfinancialsolutions.com
Premier Financial Solutions - Home
Official Site, Health insurance, Life Insurance, Long Term Care, Medicare, Medigap, Medicare Supplements, dental, Cancer insurance, Mortgage Protection, Reverse Mortgage Protection, Advantage Plans, individual and group insurance

Moz DA: 13 Moz Rank: 3.2 Semrush Rank: 7,474,114
Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

uig-me.com
Homepage - United Insurance
Homepage - United Insurance

Moz DA: 5 Moz Rank: 1.6
Categories: Business, Finance and Banking

Similar?
Yes 0 No 0

quoteworkerscomp.com
North Star Insurance Agency - Top New York Insurance Broker NY Homeowners Insurance NJ'NY Workers Comp Insurance NJ`NY Business Insurance NJ
North Star Insurance Agency. Top New York Insurance Broker and New York Insurance Agency. Find NY Homeowners Insurance NY Home Owners Insurance NJ/NY Workers Comp Insurance NJ/NY Business Insurance NJ Small Business Insurance NY Insurance Coverage for private and business clientele. North Star Insurance offers the best price possible for your insurance needs.

Categories: Finance/Banking, Business

Similar?
Yes 0 No 0

nzadvicegroup.co.nz
NZ Advice Group | Life Insurance | Home Loans | Retirement Savings | Mortgage Protection | Investments
NZ Advice Group focuses on life, trauma, income protection and health insurance. We also cover mortgages and house, contents and car insurance as well as retirement savings and investments. We are specialists in our field and deal with a range of providers.

Semrush Rank: 9,283,607
Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

westernfinancialgroup.ca
Home, Car & Business Insurance Quotes | Western Financial Group
Western Financial Group offers car, home, life, farm, personal and business insurance. Get a quote in British Columbia, Alberta, Saskatchewan, Manitoba and Ontario.

Moz DA: 40 Moz Rank: 4.3 Semrush Rank: 266,763
Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

marktoney.com
Mark Toney, Financial Advisor, Macon GA
Learn more about Mark Toney, a financial advisor in Macon GA. Offering common-sense tax, insurance, and financial solutions.

Categories: Marketing/Merchandising, Finance and Banking

Similar?
Yes 0 No 0

premiermortgages.co.uk
Home
LOOKING FOR A MORTGAGE PRODUCT? THE MORTGAGE WIZARD: Use Our Three Step Wizard to calculate your personalised search results.

Facebook ♡: 0
Categories: Finance/Banking, Newly Observed Domain

Similar?
Yes 0 No 0

getwiggins.com
Auto Insurance Birmingham | Wiggins Insurance, LLC - Wiggins Insurance
Wiggins Insurance covering all of your personal and business needs. Our convenient website allows you to request insurance quotes twenty-four hours a day. Our valued customers can also service their policies at anytime, day or night, at www.getwiggins.com.

Semrush Rank: 2,123,340
Categories: Finance/Banking, Business

Similar?
Yes 0 No 0

advisors4me.com
Top Financial Advisors | Mortgage Brokers | Mortgages, Life Insurance, Critical Illness Cover, Wealth Management and more. | Financial Advisors Near Me | advisors4me.com
advisors4me - for mortgages, mortgage protection, life insurance, critical illness cover, income protection, business protection, general insurance, pensions, healthcare insurance, estate planning, legal services, equity release, debt solutions, prepaid funeral plans, wills and investments. As well as managing your accounts and tax payments, connect with Financial Advisors, Accountants, Estate Planners, Financial Planners, Investment Advisors, Mortgage Brokers, Prepaid Funeral Plan Agents, Protection Advisors (Life Insurance, Critical illness Cover and Income Protection), Legal Professionals, Will Writers and Wealth Managers.

Semrush Rank: 7,966,379
Categories: Finance/Banking, Business

Similar?
Yes 0 No 0

johnhowells.com
John F. Howells, CLU, ChFC, CFP
John Howells has 25 years of experience providing financial strategies, products and services including life insurance, annuities and investments, college, estate, retirement and business planning. He offers personal financial public workshops in the Northern San Diego area and continuing education courses for CPAs.

Semrush Rank: 5,315,482
Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

insurance9.net
Insurance Quotes. Online Auto Insurance Quotes and Rates. Compare Car Insurance
Compare multiple online car insurance quotes and rates from top insurance companies, choose insurance company, buy car insurance policy online and start up save today.

Categories: Finance and Banking

Similar?
Yes 0 No 0

topquoteonline.co.uk
Top Quote Online - Life Insurance | Critical Illness | Income Protecion
Compare online quotes for life insurance, critical illness insurance and income protection insurance. Instant quotes and can apply online at Top Quote Online.

Semrush Rank: 13,220,145 Facebook ♡: 200,827
Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

breskeandbreske.com
Breske & Breske, Inc. Financial Planning & Wealth Management
Independent Financial Advisors specializing in Consultation, Coordination and Implementation of Business, Personal and Estate Needs. Full service to help with employee benefits, long term care, disability, life insurance quotes, Medicare Supplements, Personal and Business Planning to help business owners grow their business.

Semrush Rank: 57,288,406
Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

carrierinsurance.net
Carrier Insurance Agency: Big Enough to Serve, Small Enough to Care. - La Crosse, Onalaska, Holmen WI - Auto, Health, Dental, Group, and Life Insurance.
La Crosse, Onalaska, Holmen WI - Auto, Health, Dental, Group, and Life Insurance.

Categories: Marketing/Merchandising, Finance and Banking

Similar?
Yes 0 No 0

lundyinsurance.com
local health insurance service | La Mesa, CA | Lundy Insurance Services, Inc
Click here to learn more about us! Lundy Insurance Services is happy to help anyone in La Mesa and beyond with their health insurance needs!

Semrush Rank: 51,877,875
Categories: Business, Brokerage and Trading

Similar?
Yes 0 No 0

insurancearizona.net
Abbott & Fillmore Agency's Insurance Arizona! Online Insurance Quote Comparisons
Auto, Homeowners, Life, and Medical insurance quotes on-line from several different top companies.

Categories: Finance/Banking, Business

Similar?
Yes 0 No 0

reliablemn.com
Home - Reliable Insurance Agency
Reliable Insurance Agency is a Trusted Choice agency that will design a personal or commercial insurance program to fit your unique needs.

Semrush Rank: 1,034,596 Facebook ♡: 184
Categories: Business, Finance and Banking

Similar?
Yes 0 No 0

wealthmakerfinancialservices.com.au
WealthMaker Financial Services | Wealth Creation and Management
WealthMaker Financial Services (WMFS) expert mortgage brokers & financial planners who provide clients with personalised home loan, financial and retirement planning recommendations based on their individual financial goals. Call WMFS today on 02 9233 1111.

Semrush Rank: 28,809,352
Categories: Finance/Banking, Business

Similar?
Yes 0 No 0

ohioinsurancequote.net
Insurance Auto, Property, Commercial
Insurance for Auto Insurance, Property Insurance, Home Insurance, Commercial Insurance, Life and Health Insurance. Call 216-691-9227 for Insurance quote

Semrush Rank: 9,547,042
Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

lisibroker.com
Group Benefits By State | Amwins Connect
Group Benefits By State | Amwins Connect

Moz DA: 34 Moz Rank: 3.8 Semrush Rank: 6,095,453 Facebook ♡: 6
Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

insurance1.com
insurance1.com
Insurance available for vehicle, business and lifestyle insurances. Try our website today to see if we can help you save.

Semrush Rank: 16,641,299 Facebook ♡: 39
Categories: Travel, Business

Similar?
Yes 0 No 0

southsideconcord.org
Southside Baptist Church
Southside Baptist Church

Semrush Rank: 7,220,550

Similar?
Yes 0 No 0

michaelbranda.com
Branda Financial Services
Independent Financial Firm providing Investment, Insurance, estate planning strategies and Employee Benefit Services in Houston Texas

Semrush Rank: 39,293,728
Categories: Finance/Banking, Business

Similar?
Yes 0 No 0

nelsonbrothersagency.com

Nelson Brothers Agency Insurance - Auto, Home, Health, Life and Commercial coverage for the Iowa and Illinois area. - Nelson Brothers Agency

Nelson Brothers Agencys goal is to make the task of buying insurance as simple as possible. Get an online quote today and get better coverage at a lower price by letting us shop around for you!

Semrush Rank: 1,420,056
Categories: Business, Finance and Banking

Similar?
Yes 0 No 0

acsbrokerage.com
Advanced Corporate Solutions helps design and implement, employee benefits programs, retirement plans, executive and nonqualified deferred compensation, corporate risk management programs, and business succession plans.
We help guide organizations with the strategy, design, and execution of employee benefits programs, retirement plans, corporate risk management programs, executive nonqualified deferred compensation, and business succession plans. Our friendly and responsive partners and staff provide education and support to a plan sponsor’s executive committee and to employees, from assisting with employee on and off boarding, claims facilitation, financial wellness, human resources support, compliance assistance.

Semrush Rank: 3,933,524
Categories: Business, Finance and Banking

Similar?
Yes 0 No 0

checkmyquote.com
Life, Dental and Health Insurance Solutions | Check My Quote
Check My Quote provides individuals and businesses affordable life, health, dental, accident insurance coverage and more with personalized services that fit your need and budget.

Facebook ♡: 0
Categories: Finance/Banking, Business

Similar?
Yes 0 No 0

insureaccess.com
insureaccess.com - Domain Name For Sale | DAN.COM
The domain name InsureAccess.com is for sale. Make an offer or buy it now at a set price.

Moz DA: 4 Moz Rank: 1.3 Facebook ♡: 0
Categories: Real Estate, Finance and Banking

Similar?
Yes 0 No 0

gfapandc.com
Gateway Insurance Group - Gateway Insurance Group, Inc.
Gateway Financial Advisors, Inc. dba Quality Life Insurance Agency™ is a leading independent multiline brokerage firm committed to providing industry-best service, a superior portfolio of products and unmatched expertise. We are focused on relationships - with our clients, our carriers and our fellow agents.

Semrush Rank: 4,994,893
Categories: Business, Business

Similar?
Yes 0 No 0

kingdomfs.co.nz
Complete Financial Solution | Kingdom Financial Services, Auckland
Think different- Think Legacy - We offer Complete Financial Solution to our clients providing financial services. We offer a detailed financial analysis, Budgeting, Cash Management, Drafts of wills, Life Insurance , Health Insurance , Disability Income, Mortgage Protection Cover, Mortgage applications, Kiwi Saver. Third Party Quotes on Home, Contents, Vehicle and LIability Insurance

Categories: Finance/Banking, Business

Similar?
Yes 0 No 0

covermylife.com

Auto and Home Insurance Sales and Service from CoverMyLife.com and Damon Castillo - TWFG

Competetive Auto and Home Insurance Quotes from a source you can trust! Integrity Insurance, Damon Castillo and CoverMyLife.com!

Categories: Business, Business

Similar?
Yes 0 No 0

quotesearchlife.com
Compare Life Insurance at QuoteSearchLife.com
Save on Life Insurance compare UK brands with FREE quotes and advice today, with prices starting from just 17p a day*

Categories: Finance/Banking, Business

Similar?
Yes 0 No 0

androida1jamali.blogspot.com
اندرويد الجمالي
اندرويد الجمالي مدونة متخصص تعريب وفك شفرات وتخطي حساب جوجل وفك شفرات ملتقي المطورين العرب والاجانب في تطوير البرامج والتطبيقات وتعريب وفك شفرة وتخطي جوجل والعاب جديدة وتطبيقات متنوعة

Facebook ♡: 84
Categories: Blogs/Wiki, Personal Websites and Blogs

Similar?
Yes 0 No 0

ke.britam.com
Best Life, General & Micro Insurance Company in Kenya | Britam - Kenya - Corporate
Britam's life insurance business has become one of the key drivers of, range of financial products and services in insurance, asset management, banking and property.

Semrush Rank: 492,152
Categories: Marketing/Merchandising, Finance and Banking

Similar?
Yes 0 No 0

nupebaze.com
nupebaze - Insurance, Loan & Education
Insurance, Loan & Education

Moz DA: 55 Moz Rank: 1.8 Semrush Rank: 2,286,952
Categories: Entertainment, Entertainment

Similar?
Yes 0 No 0

quickquoteus.com

Categories: Marketing/Merchandising, Finance and Banking

Similar?
Yes 0 No 0

Suggest Site to this list (quotesearch.com)

Please only suggest if the website is similar. We do check suggested websites carefully and only approve if it's completely similar.

Site Url

Why do you think it is similar?

Email address We'll never share your email with anyone else. You'll get a confirmation email.

3 (times) seven

I'm sure it's similar Yes

quotesearch.com Reviews

No reviews have been made yet.

What is sitelike.org?

sitelike.org is a free tool to search and find Similar Websites, alternatives or related to the given site.
It helps you to find similar sites based on keyword overlap and shared audience.
Our team is manually checking and finding similar websites and also our visitors are helping us to find the best similar websites.
"Similar sites like" first finds the best and top keywords for all websites and rank them.
We also use our internal algorithm with analysing the website contents and also several web sources to determine the main topics of websites which are used to find similar websites that have the closest matching set of topics. Our ranking system uses user generated content created by our team, our visitors and also our algorithm.