Similar sites like advancedplumbingks.com

Plumbers in Lawrence, Douglas County, KS - Advanced Plumbing

Plumbers in Lawrence, Douglas County, KS - Advanced Plumbing

Categories: Marketing/Merchandising, Business
Topics: advanced plumbing, douglas county, plumbers in lawrence

advancedplumbingks.com Reviews

Sites similar to advancedplumbingks.com - Top 40 advancedplumbingks.com alternatives

callmp.net
Kansas City Plumber | Drain Cleaning by MidWest Plumbing
When you need an experienced plumber in the Kansas City area, call MidWest Plumbing.

Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

advancedplumbingmartin.com
Home - Advanced Plumbing
Certified Plumbing Repair Services In Stuart Florida, St Lucie Florida, Palm City Florida, Jensen Beach Florida and Hobe Sound Florida

Moz DA: 16 Moz Rank: 2.4 Semrush Rank: 5,905,869 Facebook ♡: 6
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

lambappraisals.com
Real Estate Appraisals - Paulding County - Cobb County - Douglas County - Carroll County - Polk County - Dallas, GA - Lamb Appraisals, LLC
Lamb Appraisals, LLC - specializing in residential GA Real Estate Property Appraisals.

Similar?
Yes 0 No 0

homesinlawrencekansas.com
McGrew Real Estate Lawrence Kansas Homes for sale lawrence ks, eudora, douglas county, ne kansas Houses for sale buying selling
McGrew Real Estate, Douglas County's largest locally owned real estate firm serving Lawrence, Eudora and Douglas County. Search, homes for sale, houses, property, properties, new construction, open houses, realtors, real estate agents, gold star homes, buying, selling, agents, listings, to buy, to sell.

Categories: Real Estate, Newly Observed Domain

Similar?
Yes 0 No 0

douglascounty-ne.gov
Douglas County - Douglas County, Nebraska
Douglas County Nebraska website.

Semrush Rank: 84,179
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

douglascountysheriff.org
Sheriff | Douglas County, WA
Our department is dedicated to providing effective and efficient law enforcement services; protecting the lives and property of the citizens of Douglas County; and ensuring the protection of all persons constitutional rights.

Categories: Government/Military, Reference

Similar?
Yes 0 No 0

dcfd.org
Douglas County Fire District No. 2 | Douglas County, OR
Providing Fire & EMS services to Douglas County. 1400 Buckhorn Road Roseburg, OR 97470 | 541-673-5503 | [email protected]

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

douglas-county-website.com
Douglas County Georgia Local Business Directory, Government, Public Schools, Parks, Recreation & Tourism
Douglas-County-Website.com provides links to official Government, Public Schools, Parks, Recreation & Tourism websites of Douglas County Georgia

Categories: Travel, Travel

Similar?
Yes 0 No 0

benningtonne.com
City of Bennington, Douglas County, Nebraska - Official Website
City of Bennington, Douglas County, Nebraska - Official Website

Moz DA: 19 Moz Rank: 3.3 Semrush Rank: 551,723 Facebook ♡: 95
Categories: Public Information, Government and Legal Organizations

Similar?
Yes 0 No 0

yoursrc.org
Senior Resource Center - for Douglas County
Senior Resource Center - for Douglas County

Moz DA: 27 Moz Rank: 3.5 Semrush Rank: 1,752,604 Facebook ♡: 268
Categories: Non-Profit/Advocacy/NGO, Business

Similar?
Yes 0 No 0

advancedplumbing.ca
Plumbing Company in Toronto | Advanced Plumbing
Advanced Plumbing is a top plumbing company in Toronto, Ontario, with award-winning maintenance. Call us today to make an appointment!

Semrush Rank: 902,511
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

localtel.com
LocalTel - Phone, Internet, Television, and Security Services for Chelan County, Douglas County, and Grant County
LocalTel - Phone, Internet, Television, and Security Services for Chelan County, Douglas County, and Grant County

Facebook ♡: 0
Categories: Search Engines, Search Engines and Portals

Similar?
Yes 0 No 0

casaofdouglascounty.org
Children's Advocacy | Douglas County, OR | CASA
Here at CASA of Douglas County, we provide safety and emotional stability to children who have been forced to leave their origin homes. Call to learn more.

Categories: Non-Profit/Advocacy/NGO, Business

Similar?
Yes 0 No 0

townofsuperior.net
Town of Superior – Douglas County, Wisconsin
Town of Superior - Douglas County, Wisconsin

Categories: Internet Services, Government and Legal Organizations

Similar?
Yes 0 No 0

superiordays.com
Superior Days | Douglas County, WI - Official Website
Superior Days | Douglas County, WI - Official Website

Moz DA: 16 Moz Rank: 2.5
Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

k9-behavior.com
K9-Behavior Company | Dog Training | Roseburg, Douglas County | OR
Learn to train your dog! K9-Behavior, serving Roseburg & Douglas County,! Group Puppy Classes, Private In-Home Pet Dog Training, Truffle Dog Training, Service Dog Training, and Dog Bite Prevention Training. We can also help with your dog’s behavior problems.

Facebook ♡: 0
Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

dcga.us
Douglas County, GA | Official Website
Douglas County, GA | Official Website

Semrush Rank: 685,438
Categories: Public Information, Government and Legal Organizations

Similar?
Yes 0 No 0

volunteerdouglascounty.org
Roger Hill Volunteer Center • Douglas County, KS
Roger Hill Volunteer Center • Douglas County, KS

Categories: Education/Reference, Business

Similar?
Yes 0 No 0

douglascountyhomecareassistance.com
Home Care | Castle Rock, CO | Douglas County, CO
Home Care Services at Home Care Assistance of Douglas County, CO: Providing professional home care to seniors in need of assistance in Castle Rock, CO

Semrush Rank: 2,919,675
Categories: Marketing/Merchandising, Health and Wellness

Similar?
Yes 0 No 0

carolyngoff.com
Douglas County, Nevada (NV) Real Estate - Courtesy of Carolyn Goff
The road to success may not be paved like the yellow-brick road in Oz, but it sure helps to have a knowledgeable guide to get you where you want to go. As one of the area�s premier real estate professionals, Carolyn Goff uses her extensive area knowledge and broad business background to help you find the way home. She truly is the one to know for your next move.

Semrush Rank: 16,270,295
Categories: Real Estate, Real Estate

Similar?
Yes 0 No 0

douglascountywi.org
Douglas County, WI - Official Website | Official Website
Douglas County, WI - Official Website | Official Website

Facebook ♡: 13
Categories: Public Information, Government and Legal Organizations

Similar?
Yes 0 No 0

douglascountywa.net
Douglas County, WA | Official Website
Douglas County, WA | Official Website

Facebook ♡: 3
Categories: Public Information, Reference

Similar?
Yes 0 No 0

newsandviewsusa.com
Events • Tips • Info - Community magazines published by News & Views USA, Inc. Serving Douglas County, Paulding County, Villa Rica, and Temple in West Georgia. A trusted company and source of advertising for approximately 300 local businesses each month. Ad rates start at $52 per month.

Facebook ♡: 390
Categories: General News, News and Media

Similar?
Yes 0 No 0

celebratedouglascounty.com
Douglas County, GA | Official Website
Douglas County, GA | Official Website

Semrush Rank: 60,496 Facebook ♡: 175
Categories: Public Information, Government and Legal Organizations

Similar?
Yes 0 No 0

douglascountycasa.org
CASA volunteer | Douglas County, GA | Help children
Community volunteers, like you, help foster children everyday in Douglas County, GA to find safe, permanent, loving homes.

Semrush Rank: 6,470,944
Categories: Blogs/Wiki, Information Technology

Similar?
Yes 0 No 0

douglascounty-oregon.us
Douglas County, OR | Official Website
Douglas County, OR | Official Website

Semrush Rank: 128,758
Categories: Government/Military, Business

Similar?
Yes 0 No 0

travismcneil.com
Search HOMES - Castle Pines, Castle Rock, Denver, Douglas County
Search homes in Castle Pines, Castle Rock, Aurora, Denver Metro, Douglas County. Find REO, bank owned, short sale, foreclosed homes.

Categories: Real Estate, Real Estate

Similar?
Yes 0 No 0

douglas.lib.nv.us

Facebook ♡: 0
Categories: Marketing/Merchandising, Reference

Similar?
Yes 0 No 0

gordonpinesgolfcourse.com
Gordon Pines Golf Course, Gordon, Wisconsin, Douglas County, 6809 E Fire Hill Road
This is the official website for Gordon Pines Golf Course in Gordon, Wisconsin. Here you will find our rates, league information, event calendars, course info and layout, banquet facilities info, directions to our golf course, our photo gallery and more.

Categories: Sports, Society and Lifestyles

Similar?
Yes 0 No 0

jordandechtman.com
Jordan Dechtman Wealth Management Denver | Financial Advisor | Investment Planner Centennial, Douglas County, Castle Rock, Colorado Springs, Highlands Ranch, Greenwood Village, Cherry Hills Village, Columbine, Castle Pines, Boulder, Mapleton Hill, Englewood, Colorado
Jordan Dechtman Wealth Management provides you expert advice, personally delivered for financially successful individuals. Call 303-741-9772

Categories: Finance/Banking, Finance and Banking

Similar?
Yes 0 No 0

firemed.us
FireMed | Douglas County, OR
Fire Med is a Fire and Ambulance services membership in Central Douglas County, OR.

Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

pennymchenryhydrangeafestival.com
Douglas County, GA • CivicEngage
Douglas County, GA • CivicEngage

Categories: Public Information, Restaurant and Dining

Similar?
Yes 0 No 0

brule-wi.org
Home - Town of Brule, Douglas County, Wisconsin
Welcome to the Town of Brule Douglas County, Wisconsin ~ Home to the River...

Categories: Public Information, Government and Legal Organizations

Similar?
Yes 0 No 0

advanced-plumbing.net
Advanced Plumbing Front Page - Advanced Plumbing
Advanced Plumbing – The Leaders in Plumbing Repair and Renovations! Advanced Plumbing has been a leader in the plumbing industry since 2008, providing unparalleled service to our customers in Oakland, Macomb and Wayne counties in Michigan and their respective surrounding areas. For excellence in plumbing, repairs, installation, water heaters or water softeners service, Advanced Plumbing is the only name you…

Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

samturcolawoffices.com
Omaha Nebraska Chapter 7 Bankruptcy Attorney | Lincoln NE Chapter 13 Bankruptcy Lawyer | Douglas County
Burdened by debt? Sam Turco Law Offices of Lincoln, Omaha and Grand Island offers experienced bankruptcy and debt relief counsel. Call 402-682-8573 in Omaha or toll-free at 866-593-7397 for a free consultation.

Categories: Business, Government and Legal Organizations

Similar?
Yes 0 No 0

krusefarms.com
Kruse Farms located in Roseburg, Douglas County, Oregon. Produce, Market and Gift Baskets.
Kruse Farms located in Roseburg, Douglas County, Oregon. Produce, Market and Gift Baskets.

Categories: Online Shopping, Business

Similar?
Yes 0 No 0

ewperio.com
Plumbers in Lawrence, Douglas County, KS - Advanced Plumbing
Call Advanced Plumbing in Douglas County, Kansas for your plumbing needs. Be sure to also check out our Remodeling Services

Categories: Health, Business

Similar?
Yes 0 No 0

aceplumbingkansas.com
Ace Plumbing, Heating, Air Conditioning, Appliance Repair, Topeka, Lawrence KS
Your Local Plumbing, Heating, Air Conditioning and Appliance Repair Service Provider. Ace serves Topeka and Shawnee County and Lawrence KS. Service, Air Conditioner Repair, Furnace Repair, Appliance Repair, Plumbing, Clogged drains, Sewer repair, Water Heaters, Backflow Testing and more.

Categories: Marketing/Merchandising, Business

Similar?
Yes 0 No 0

ah-air.com
A&H Air Conditioning and Heating - Lawrence, Ottawa, Baldwim City, KS
A & H provides commercial and residential heating, air conditioning, mechanical and plumbing services. We are open 24 hours 7 days a week!

Categories: Business, Business

Similar?
Yes 0 No 0

recyclepower.org
IIS Windows Server

Facebook ♡: 5
Categories: Public Information, Society and Lifestyles

Similar?
Yes 0 No 0

Suggest Site to this list (advancedplumbingks.com)

Please only suggest if the website is similar. We do check suggested websites carefully and only approve if it's completely similar.

Site Url

Why do you think it is similar?

Email address We'll never share your email with anyone else. You'll get a confirmation email.

3 (times) seven

I'm sure it's similar Yes

advancedplumbingks.com Reviews

No reviews have been made yet.

What is sitelike.org?

sitelike.org is a free tool to search and find Similar Websites, alternatives or related to the given site.
It helps you to find similar sites based on keyword overlap and shared audience.
Our team is manually checking and finding similar websites and also our visitors are helping us to find the best similar websites.
"Similar sites like" first finds the best and top keywords for all websites and rank them.
We also use our internal algorithm with analysing the website contents and also several web sources to determine the main topics of websites which are used to find similar websites that have the closest matching set of topics. Our ranking system uses user generated content created by our team, our visitors and also our algorithm.